#Biodiversity150 number 118 of 150 Eastern Hognose Snake

118/150: A snake that plays possum

Animalia: Chordata: Reptilia: Squamata: Colubridae: Dipsadinae: Heterodon: Heterodon platirhinos (Latreille, 1801)

The eastern hognose snake is named for its distinctive upturned snout, which it uses to dig through sandy soil. Individuals average about 28 inches in length, with the females typically being larger than males. They are found in several pockets of eastern North America, and can come in a variety of colour combinations depending on their locale. Possible colours include brown, grey, black, red, orange and green. While the eastern hognose is considered non-venomous to humans, they do have a mild venom specific to amphibians. They’re notably fond of eating toads, and to get around the toxins found in a toad’s skin, they can produce a hormone to counteract the poison. These snakes are also very impressive actors, and are known to convincingly play dead when threatened. They’ll even let their tongues hang out and secrete a foul musk to help sell the performance. #Canada150 #Biodiversity150

An Eastern Hognose Snake sitting in the grass. Photo Credit: Peter Gorman goo.gl/E4xSFC
Specimen AVB080621-01 – Ontario, Canada – 21-Jun-2008. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics

Here’s the barcode sequence information for this species:

Process ID: ABRC013-09

nucleotide sequence

AACCCTATACCTACTTTTTGGGACTTGAGCAGGCCTAATGGGGGCCTGCCTAAGCATTCTTATACGAATAGAGCTAACACAGCCTGGCTCCTTATTCGGTAATGACCAAATCTATAATGTCCTAGTCACAGCTCACGCATTCATTATAATCTTTTTTATAGTAATACCTATCATAATCGGGGGATTTGGAAACTGATTAATCCCTTTAATAATTGGGGCCCCAGATATAGCCTTCCCTCGAATAAACAATATAAGCTTCTGACTTCTACCCCCAGCACTACTTCTCCTACTTTCCTCATCCTATGTTGAAGCTGGAGTAGGCACGGGCTGGACTGTGTACCCTCCTCTATCAGGGAACCTAGTTCACTCAGGCCCATCAGTAGACCTGGCGATCTTCTCTCTTCATTTGGCTGGGGCTTCCTCCATCCTGGGGGCAATTAACTTCATTACAACATGCATTAATATGAAACCTAAATCAATACCTATATTTAACATCCCCTTATTCGTCTGATCAGTACTAATTACTGCCATTATGTTGCTCCTAGCTCTACCCGTGCTGGCAGCAGCTATTACCATGCTACTTACAGACCGAAATCTTAACACCTCTTTCTTTGACCCATGCGGTGGAGGGGACCCTGTCTTA—————

amino acid sequence

TLYLLFGTWAGLMGACLSILMRMELTQPGSLFGNDQIYNVLVTAHAFIMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPALLLLLSSSYVEAGVGTGWTVYPPLSGNLVHSGPSVDLAIFSLHLAGASSILGAINFITTCINMKPKSMPMFNIPLFVWSVLITAIMLLLALPVLAAAITMLLTDRNLNTSFFDPCGGGDPVL—–

Visual representation of DNA barcode sequence for Eastern Hognose Snake

Learn more about it’s BIN (Barcode Index Number): BOLD:AAG3890

Leave a Reply

Your email address will not be published. Required fields are marked *