#Biodiversity150 number 137 of 150 Gibothorax tchernovi

137/150: Lonely Since 1989

Animalia: Arthopoda: Arachnida: Araneae: Linyphiidae: Gibothorax tchernovi (Eskov, 1989)

Spiders that belong to the group of Linyphiidae are made up of small spiders with more than 4,300 species globally. They are more commonly known as money spiders in the United Kingdom and Australia because they were linked with having good luck. New spiders within this family are still being found as with the case of Gibothorax tchernovi that lives on islands in Canada’s North. The small size of these organisms makes taxonomically classifying them a challenge and species have been divided and regrouped numerous times. The genus Gibothorax still only has one species within its group over a span of 28 years since its initial discovery. Hopefully more spiders under the Gibothorax genus will be discovered, and fingers crossed that they’ll be found in Canada!  #Canada150 #Biodiversity150

CCDB-05148-A09 – Hershel Island, Yukon Territory – 04-Jul-2007. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Example habitat where G. tchernovi can be found. Photo Credit: Kiril Strax goo.gl/mHfpSH

Here’s the barcode sequence information for this species:

Process ID: SPIAI864-10

nucleotide sequence

AAGTTTATATTTTATTTTTGGGGCATGGGCTGCTATAGTAGGGACAGCAATAAGAGTGTTAATTCGAATTGAGTTAGGGCAAACTGGTAGATTATTAGGGGATGATCAATTGTATAATGTAATTGTTACTGCTCATGCGTTTATTATGATTTTTTTTATAGTTATACCTATTTTGATTGGGGGATTTGGAAATTGGTTAGTCCCATTAATATTAGGGGCACCGGATATGGCTTTCCCACGAATAAATAATTTAAGTTTTTGGTTATTACCCCCTTCTTTATTATTATTGTTTATTTCTAGAATGGATGAAATAGGGGTAGGAGCTGGATGAACTATTTATCCTCCTCTTGCTTCTTTGGAGGGGCATTCTGGAAGTTCAGTAGATTTTGCTATTTTTTCTTTGCATTTGGCTGGGGCTTCTTCAATTATAGGGGCTATTAATTTTATTTCTACTATTTTGAATATACGAGGTTATGGAATAACTATAGAAAAAGTACCTTTATTTGTTTGGTCTGTTTTAATTACAGCTGTATTATTATTATTATCTTTACCTGTTTTAGCAGGTGCTATTACTATGCTTTTAACTGATCGAAATTTTAATACTTCATTTTTTGATCCTTCTGGAGGAGGGGATCCAGTATTATTTCAACATTTATTT

amino acid sequence

SLYFIFGAWAAMVGTAMSVLIRIELGQTGSLLGDDQLYNVIVTAHAFIMIFFMVMPILIGGFGNWLVPLMLGAPDMAFPRMNNLSFWLLPPSLLLLFISSMDEMGVGAGWTIYPPLASLEGHSGSSVDFAIFSLHLAGASSIMGAINFISTILNMRGYGMTMEKVPLFVWSVLITAVLLLLSLPVLAGAITMLLTDRNFNTSFFDPSGGGDPVLFQHLF

Visual representation of DNA barcode sequence for Gibothorax tchernovi

Learn more about it’s BIN (Barcode Index Number): BOLD:AAG5706

Leave a Reply

Your email address will not be published. Required fields are marked *