Animalia: Arthropoda: Insecta: Diptera: Lonchopteridae: Lonchoptera: Lonchoptera bifurcata (Fallen, 1810)

Lonchoptera bifurcata is known as a pointed-winged or spear winged fly with a Holarctic distribution. This means the species is found in all non-tropical regions across North America, Europe, Asia, and Africa! The fly can be distinguished from similar species due to the pale-coloured bristles behind the eye, bristles on the front of the tibiae of the first legs, and the distinct sharply pointed wings. L. bifurcata are found in different areas depending on the life stage. Larvae will be found among decaying organic matter like leaves and logs, while adults are more commonly found in most ditches and damp lawns. What’s interesting is that males of the species are not that commonly found, because of this, females have been found to produce young parthenogenetically where unfertilized eggs develop into live young! #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID: BBDIP089-09

nucleotide sequence

AACTTTATATTTTATTTTTGGAGCTTGAGCAGGAATAGTAGGTACTTCTCTTAGAATTTTAATTCGAGCTGAATTAGGAAATCCAGGAGCTTTAATTGGTGATGATCAAATTTATAATGTGATTGTTACAGCTCATGCTTTTGTAATAATTTTTTTTATAGTTATACCTATTATAATTGGAGGGTTTGGAAATTGATTAGTTCCTTTAATATTAGGAGCACCAGACATAGCATTCCCTCGAATAAATAATATAAGATTTTGAATATTACCTCCATCTTTAACCCTTTTATTAGCCAGTAGTATAGTAGAAAATGGAGCTGGAACAGGATGAACAGTTTATCCTCCTTTATCCTCTGGAATTGCTCATGCTGGAGCATCTGTTGATTTAGCAATTTTTTCATTACATTTAGCTGGAATTTCTTCTATTTTAGGAGCTGTTAATTTTATTACAACTGTTATTAATATACGTTCATCAGGAATAAGTTTTGATCGAATACCTTTATTTGTTTGATCTGTAGTAATTACTGCTTTATTATTATTATTATCTTTACCTGTATTAGCTGGAGCTATCACAATATTATTAACAGATCGAAATTTAAATACTTCTTTTTTTGACCCTGCTGGAGGAGGAGATCCTATTCTTTATCAACATTTATTT

amino acid sequence

TLYFIFGAWAGMVGTSLSILIRAELGNPGALIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWMLPPSLTLLLASSMVENGAGTGWTVYPPLSSGIAHAGASVDLAIFSLHLAGISSILGAVNFITTVINMRSSGMSFDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Learn more about it’s BIN (Barcode Index Number): BOLD:AAG9974