#Biodiversity150 number 16 of 150 Globular Springtail

16/150: What’s your mating strategy?

Animalia: Arthropoda: Collembola: Symphypleona: Sminthuridae: Allacma: Allacma fusca (Linnaeus, 1758)

Allacma fusca is a species of globular springtail (Collembola) originally found in western continental Europe and the British Isles. Most globular springtails have a unique and rather strange mating ritual compared to their plump springtail and slender springtail relatives. While facing each other, a male globular springtail will use his modified antennae to grip the female by her antennae. The female then shakes him around in the air until his sperm is released onto the ground – now called the “spermatophore“.  The males will then attempt to drag the female to the spermatophore so she can take it up into her body. It can often be difficult for the males to do this as they are usually smaller than the females! 195 barcodes of this species are on BOLD. #Canada150 #Biodiversity150

Allacma fusca from the United Kingdom. Photo Credit: Andy Murray goo.gl/BkNOum
Juvenile Allacma fusca from United Kingdom. Photo Credit: Andy Murray goo.gl/DkLefE

Check out this cool video of their mating ritual!

Here’s the barcode sequence information for this species:

Process ID:  GMFIF579-12

nucleotide sequence

AACCCTATATCTTATTATAGGTGTTTGATCAGCAATAGTTGGGACGGCCTTTAGAGTCCTAATTCGACTTGAATTGGGACAACCGGGTAGCCTAATTGGAAATGATCAAATCTACAATGTTCTAGTCACATCACACGCCTTCATTATGATTTTCTTCATAGTTATACCAATTATAATCGGAGGATTCGGAAATTGGCTAGTTCCAATAATAATCGGAGCCCCTGATATAGCTTTCCCTCGAATAAATAACATAAGATTCTGACTTCTACCTCCAGCATTAACCCTTCTTTTAATAGGGGCCGCGGTAGAAAGGGGGGCAGGTACTGGATGAACAGTCTACCCTCCTTTAGCATCTTCAGTAGCACACTCAGGAGCCTCAGTTGATTTAACTATTTTTAGCCTTCATCTTGCAGGGATTTCATCAATTCTAGGGGCCATCAATTTCATTACTACTATTATTAATATACGAGCCCCAGGAATAGAATGGGACCTTGTGCCTTTATTCGTTTGATCAGTAATTATTACAGCAGTTCTCCTACTACTCTCACTTCCTGTTCTTGCAGGAGCAATTACTATACTTCTAACAGATCGTAATCTAAATACCTCTTTCTTTGATCCTGC———————–

amino acid sequence

TLYLIMGVWSAMVGTAFSVLIRLELGQPGSLIGNDQIYNVLVTSHAFIMIFFMVMPIMIGGFGNWLVPMMIGAPDMAFPRMNNMSFWLLPPALTLLLMGAAVESGAGTGWTVYPPLASSVAHSGASVDLTIFSLHLAGISSILGAINFITTIINMRAPGMEWDLVPLFVWSVIITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPX——–

Visual representation of DNA barcode sequence for Globular Springtail

Learn more about it’s BIN (Barcode Index Number): BOLD:AAN9178

Title Image: Specimen BIOUG04213-A10 – Oulu, Northeast of Kiiminki, Finland – 3-Aug-2012 – Malaise Trap
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics

Leave a Reply

Your email address will not be published. Required fields are marked *