#Biodiversity150 number 32 of 150 Rana sylvatica

32/150: Put a spring in your step and celebrate frogs with us!

Animalia: Chordata: Amphibia: Anura: Ranidae: Rana: Rana sylvatica LeConte, 1825

It’s officially the first day of spring (finally!) and it also happens to be World Frog Day! Check out this cool infographic about frogs made by the National Aquarium in Baltimore to learn more about these cool creatures.

Photo Credit: National Aquarium in Baltimore

Although it doesn’t feel like spring right now, the Wood Frog (Rana sylvatica) may soon start to emerge for breeding once the snow melts; they are one of the first amphibians to emerge after winter. Wood frogs have a broad range across North America, and can tolerate the freezing of their blood and other tissues while they enter dormancy during winter. The frogs accumulate urea and glucose in their tissues, which act as cryoprotectants to protect from freezing. Wood frogs can survive several freeze/thaw events during winter! They live in forests and breed mostly in vernal ponds or ephemeral wetlands. This can be a good and a bad thing, as vernal pools are less likely to have large predators like fish, but can also dry up before their offspring have a chance to metamorphose. However, by being some of the first frogs to breed in early spring, it increases the tadpoles’ likelihoods of metamorphosing before ponds can dry up. #WorldFrogDay #FirstDayofSpring #Canada150 #Biodiversity150

 

Wood frogs are probably superheroes because they always wear a mask. Photo Credit: Brian Gratwicke goo.gl/ae5wdd
A male and female wood frog breeding pair. A male frog clasps the female behind her arms and hook his thumbs around her (called “amplexus”) until the female deposits the eggs. Photo Credit: Andrew Hoffman goo.gl/boCWIm
Geographic range of the wood frog, Rana sylvatica. Photo Credit: United States Geological Survey goo.gl/q2FA3h

Here’s the barcode sequence information for this species:

Process ID:  CNPVT139-16

nucleotide sequence

AACCCTTTATTTAATCTTTGGCGCCTGGGCCGGGATAGTCGGAACAGCTCTAAGTCTGCTTATTCGCGCAGAATTAAGTCAACCGGGAACACTCCTCGGCGATGATCAAATTTATAACGTTATTGTTACTGCTCATGCATTTGTTATAATCTTCTTTATGGTTATGCCAATTTTAATCGGGGGTTTTGGTAATTGACTAATCCCCCTAATAATTGGAGCCCCTGACATGGCATTCCCCCGAATAAACAATATAAGCTTCTGACTCTTACCCCCATCCTTCTTCCTCCTTCTAGCCTCTTCTACAGTAGAAGCTGGAGCTGGTACAGGTTGAACAGTTTATCCACCCTTAGCCGGAAATCTAGCCCATGCAGGCCCCTCAGTAGATTTAGCTATTTTCTCACTACACCTAGCTGGTGTTTCATCTATCTTGGGGGCTATTAATTTTATTACCACAATCATTAATATAAAACCCTCATCAACTACACAATATCAAACACCTCTTTTTGTTTGATCCGTACTAATTACTGCAGTCCTGCTTCTCTTATCACTCCCAGTTTTAGCTGCTGGAATCACCATACTCCTGACTGACCGCAATTTAAACACCACCTTTTTTGACCCTGCAGGAGGCGGTGATCCAGTTCTATACCAACACTTATTC

amino acid sequence

TLYLIFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPILIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSFFLLLASSTVEAGAGTGWTVYPPLAGNLAHAGPSVDLAIFSLHLAGVSSILGAINFITTIINMKPSSTTQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLF

Visual representation of DNA barcode sequence for Rana sylvatica

Learn more about it’s BIN (Barcode Index Number): BOLD:AAA5418

Leave a Reply

Your email address will not be published. Required fields are marked *