#Biodiversity150 number 49 of 150 Arctic Tern

49/150: BEHOLD! The longest migration of any bird, The Arctic Tern

Animalia: Chordata: Aves: Charadriformes: Laridae: Sterna: Sterna paradisaea (Pontoppidan, 1763)

The Arctic Tern (Sterna paradisaea) is a winter, sea-faring bird with the longest yearly migration of any known species. They will travel a total of 70,900 km in one year from their breeding site in Northern Canada and Europe to their winter home near Antarctica. They breed at 3-4 years of age in the open tundra, boreal forest or rocky islands and beaches. They make nests out of gravel, grass or surrounding vegetation on the ground for their clutch of 1-3 eggs. Often Arctic terns will return to the area they were hatched to breed as adults. These medium sized, agile birds dive into the water from flight to catch fish, also feeding on crustaceans and flying insects. The Arctic tern can live for decades and have a current estimated population of 1 million. There are 14 representatives on BOLD with barcode records. #Canada150 #Biodiversity150

An Arctic Tern at the Farnes on the North Sea. Photo Credit: Blake Matheson goo.gl/PFo3LR
An Arctic Tern catching a meal. Photo Credit: Dunpharlain goo.gl/Ghd2A2

Here’s the barcode sequence information for this species:

Process ID:  TZBNA143-03

nucleotide sequence

NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCTTAGCCTACTCATTCGCGCAGAACTAGGCCAACCAGGAACCCTCCTAGGAGATGACCAAATCTATAACGTAATCGTCACCGCCCACGCCTTTGTAATAATCTTCTTCATAGTAATACCCATCATAATTGGGGGCTTCGGAAACTGATTAGTCCCACTTATTATTGGTGCCCCCGACATGGCATTCCCGCGCATAAACAACATAAGCTTCTGACTGCTTCCTCCATCATTCTTACTTCTCCTAGCCTCCTCTACAGTAGAGGCTGGAGCAGGCACAGGATGAACTGTATATCCCCCTCTAGCTGGTAATCTAGCCCATGCTGGGGCTTCAGTAGACTTGGCAATCTTCTCCCTCCACCTAGCAGGTGTGTCCTCTATCCTGGGTGCTATCAACTTTATCACCACGGCCATCAACATAAAACCCCCTGCCCTTTCACAATACCAAACCCCTCTATTTGTATGATCAGTACTTATCACTGCCGTCCTACTACTACTCTCGCTCCCAGTACTCGCCGCCGGCATCACTATATTATTAACAGACCGAAACCTAAACACAACGTTCTTTGACCCTGCTGGGGGTGGTGACCCTGTACTATATCAACATCTATTCTGATTTTTTGGTCACCCCTGNATAAAAANNNAAANNNGN

amino acid sequence

LSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLIIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAGVSSILGAINFITTAINMKPPALSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPVLYQHLFWFFGHPXMKXXXX

Visual representation of DNA barcode sequence for Arctic Tern

Learn more about it’s BIN (Barcode Index Number): BOLD:AAC2358

Title Image: Arctic Tern
Photo Credit: Andreas Weith (AWeith) goo.gl/cU6myx

 

 

 

Leave a Reply

Your email address will not be published. Required fields are marked *