#Biodiversity150 number 56 of 150 Moose

56/150: Are Moose mothers baby thieves?

Chordata: Mammalia: Artiodactyla: Cervidae: Capreolinae: Alces: Alces americanus (Linnaeus, 1758)

The second week of May begins the start of moose baby season! Baby moose clock in at approximately 30 pounds and can outrun a person within the first five days. Moose calves and their mothers bond quickly and calves are observed calling and attempting to rouse their mothers into playing (usually without success). Bulls are usually kicked out of the nest the following year, but have been recorded staying with the mother for multiple years if she is unable to get pregnant. Adult females have been observed fostering orphaned calves both in both captivity and in the wild. Things can take a turn for the sinister when females can’t get pregnant, as they may “steal” another mother’s calf and raise it as their own. In Newfoundland, the 150,000 moose recorded are descendants from just four moose that were introduced in the 1900’s. There are 18 Moose with barcodes on BOLD. #Canada150 #Biodiversity150

Baby Moose that was rehabilitated in Ontario. Photo Credit: Katelyn Hill
Mother Moose and her two twins. Photo Credit: Shaun Cassan
Baby Moose playing in lake. Photo Credit: p2-r2 goo.gl/BPZgs9
A moose grazing in a meadow. Photo Credit: Kent Miller at National Park and Preserve Alaska goo.gl/3BV5PJ

Here’s the barcode sequence information for this species:

Process ID:  ABMWC046-06

nucleotide sequence

NNNNNNNNNTTATTATTTGGTGCTTGAGCAGGCATAGTAGGAACGGCCCTAAGCTTATTAATCCGTGCTGAATTAGGCCAACCTGGAACCCTGCTCGGGGATGATCAAATCTATAATGTAATCGTAACTGCACACGCATTCGTAATAATTTTCTTTATAGTAATACCAATCATAATTGGAGGTTTTGGTAACTGACTTGTTCCCTTGATGATTGGTGCCCCTGATATAGCATTCCCTCGAATAAACAATATGAGTTTCTGACTCCTACCTCCCTCCTTTTTACTGCTTCTAGCATCATCTATAGTTGAAGCCGGAGCAGGCACAGGCTGAACTGTTTATCCCCCTTTAGCTGGAAATCTAGCCCACGCAGGAGCTTCAGTAGACCTAACCATTTTTTCCTTACACTTAGCAGGTGTCTCTTCAATTCTAGGGGCTATTAATTTTATTACAACAATTATTAATATAAAACCCCCTGCTATATCACAATATCAAACCCCTCTATTTGTATGATCAGTACTAATTACTGCTGTACTATTACTTCTTTCACTCCCTGTACTAGCAGCCGGAATTACAATATTATTAACAGACCGAAACTTAAATACAACTTTCTTTGACCCGGCAGGAGGCGGAGATCCTATTCTATATCAACACTTANNN

amino acid sequence

LLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL

Visual representation of DNA barcode sequence for Moose

Learn more about it’s BIN (Barcode Index Number): BOLD:AAB7972

Leave a Reply

Your email address will not be published. Required fields are marked *