#Biodiversity150 number 8 of 150 Bryozoa

8/150: I’m so much more than just moss!

Animalia: Bryozoa: Phylactolaemata: Plumatellida: Fredericellidae

Bryozoa, commonly known as moss animals are a phylum of aquatic invertebrate animals. A single individual, known as a zooid, is typically 0.5 millimeters long. Bryozoans are an immobile species typically residing on hard surfaces such as stone or even your summer cabin’s docks! While these are often thought of as a nuisance, these animals are much more than what they initially seem. Anywhere from a few to millions of zooids come together to form colonies composed of zooids that are responsible for feeding and excretion (autozooids) and non-feeding zooids which are responsible for reproduction and defense of the colony (heterozooids). The feeding zooids contain a lophophore which is a ring of ciliated tentacles around the mouth, used to capture small food particles in the water. Most bryozoans are hermaphroditic, therefore both the ova and sperm are released into the water by the heterozooids for fertilization or others capture sperm via their lophophores to fertilize their ova internally. These plant-looking animals are pretty cool! #Canada150 #Biodiversity150

Freshwater bryozoan colony. Photo Credit: Roger Smith goo.gl/PSbgcy
Freshwater bryozoan from a lake in North Carolina, USA. Photo Credit: TheAlphaWolf goo.gl/B0ATa8

Here’s the barcode sequence information for this species:

Process ID: RBNII107-13

nucleotide sequence

GACCTTATACTTTTTATTTGGTATATGATCAGGACTAGTAGGTAGGAGTTTAAGGTTTCTTATTCGGGCTGAACTAGGTCAACCTGGAGCCTTATTCGGTGACGATCAGCTTTATAATGTGATTGTTACAGCACATGCATTTGTTATAATCTTTTTCCTTGTCATGCCAGTGATGTTAGGGGGATTCGGAAATTGATTGGTTCCTTTAATGTTAGGAGCCCCTGACATGGCATTTCCTCGTTTGAATAACATGAGGTTCTGACTTTTACCTCCATCACTCTTACTATTATTATCTTCAGCCCTTGTGGAGAGAGGGGCGGGCACAGGATGGACTGTTTATCCCCCCTTATCTTCTAATGTCTCTCATGCAGGAAGATCTGTAGACTTGGCCATTTTCTCCTTACACTTGGCTGGTGTCTCTTCTATTCTGGGGGCTCTGAATTTCATTACTACGATCATGAACAT—ACGATGAGGTGGAATAACTATAGAGCGAGTCCCTCTGTTTGCTTGATCCATTCTTATTACAGCAATTCTTCTCTTACTGTCTCTACCTGTTCTGGCTGGTGCTATTACAATGCTCCTAACAGACCGTAATTTTAACACTTCGTTCTTTGATCCAGCAGGAGGGGGTGACCCTATTCTCTTTCAACACCTGTTT

amino acid sequence

TLYFLFGMWSGLVGSSLSFLIRAELGQPGALFGDDQLYNVIVTAHAFVMIFFLVMPVMLGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLLLLLSSALVESGAGTGWTVYPPLSSNVSHAGSSVDLAIFSLHLAGVSSILGALNFITTIMNXXRWGGMTMERVPLFAWSILITAILLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILFQHLF

Learn more about it’s BIN (Barcode Index Number): BOLD:ACJ0223

Title Image: Specimen ON13-C4944-0002 – Rouge National Urban Park – 14-Sep-2013
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics

Leave a Reply

Your email address will not be published. Required fields are marked *