#Biodiversity150 number 9 of 150 Fairy Shrimp

9/150: Fairly Shore it’s a Fairy Shrimp

Animalia: Arthropoda: Branchiopoda : Anostraca: Branchinectida: Branchinecta: Branchinecta paludosa (O. F. Müller, 1788)

Branchinecta paludosa is a species of fairy shrimp found almost everywhere in the northern hemisphere, and one of the only four species of fairy shrimp that are freshwater inhabitants. Most species in the fairy shrimp group have several pairs of swimming legs, which they utilize to swim upside-down, and they tend to live in pools without fish! Branchinecta paludosa have been found in small lakes, eat organic particles and algae, and are an important food source for many species of fish. Their eggs are extremely drought and freezing resistant which enables them to survive the Arctic winter, and any summer droughts too. Fairy shrimp in general are used by humans for fish food in aquaculture practices. Because their eggs are so hardy, they are easily stored, re-hydrated, hatched, and supplied to fish stocks. #Canada150 #Biodiversity150

Epic identification aide diagram of Branchinecta paludosa. Photo Credit: Illustration from Fauna Norvegiae, by Georg Ossian Sars (1896) goo.gl/abx1YK
A fairy shrimp in its natural habitat. Photo Credit: coniferconifer goo.gl/7S1xXL

Here’s the barcode sequence information for this species:

Process ID:  SABRA118-08

nucleotide sequence

AACACTTTATTTTATTTTTGGAGCATGATCAGGCATAGTGGGAACTTCTTTAAGAATACTAATTCGAGCGGAATTAGGTCAACCCGGATCGCTTTTAGGAGATGAGCAGTTATATAATGTGATTGTGACCGCCCATGCGTTCATTATGATTTTCTTTATAGTTATACCAATCTTAATTGGAGGATTCGGGAACTGACTAGTGCCTATTATATTAGGAGCCCCAGATATAGCATTCCCACGACTAAATAATCTAAGATTTTGAATACTACCTCCTGCCTTGACTTTGCTCCTGGCAGGTTCAATGGTAGAAAGAGGGGCCGGGACCGGATGAACGGTCTACCCTCCTCTTTCTGCAGGAATTGCCCATGCAGGACCTTCAGTGGACCTTTCTATCTTTTCCCTTCATCTAGCCGGTATCTCGTCGATTCTTGGTGCTGTAAATTTTATTACGACGATCTTAAATATGCGACCCTCATCTATATCACTGGACCGTATGCCCCTATTTGTCTGATCTGTGGGTATTACAGCTGTCCTTCTTCTTCTGTCCCTCCCTGTTCTAGCAGGGGCTATTACTATGCTACTCACGGATCGTAACCTAAATACTTCTTTTTTTGACCCGGCAGGAGGGGGGGACCCTATTCTCTACCAACATTTGTTT

amino acid sequence

TLYFIFGAWSGMVGTSLSMLIRAELGQPGSLLGDEQLYNVIVTAHAFIMIFFMVMPILIGGFGNWLVPIMLGAPDMAFPRLNNLSFWMLPPALTLLLAGSMVESGAGTGWTVYPPLSAGIAHAGPSVDLSIFSLHLAGISSILGAVNFITTILNMRPSSMSLDRMPLFVWSVGITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Learn more about it’s BIN (Barcode Index Number): BOLD:AAB2942

Title Image: Specimen 08PROBE-2069 – Churchill, Manitoba – 13-Jul-2008 – Dip Net
Photo Credit: CBG Photography Group, Centre For Biodiversity Genomics

Leave a Reply

Your email address will not be published. Required fields are marked *