Author: Jaclyn McKeown

146/150: Engelmann’s Quillwort is under threat! Only 2000 left in Canada

Posted on by Jaclyn McKeown
Plantae: Lycopodiophyta: Isoetopsida: Isoetales: Isoetaceae: Isoetes: Isoetes engelmannii (A.Braun.)

The Engelmann’s Quillwort (Isoetes engelmannii), also known as Appalachian Quillwort, is an aquatic plant found along shallow ponds, temporary shallow pools, roadside ditches and marshes. It is small fern that is 20-40 cm in height but can grow up to 90 cm. It has long, thin, hollow green leaves. It is uncommon but widespread throughout eastern North America. In Canada, it is native but only found in two locations in Ontario restricted to two rivers. For this reason, it is considered endangered in Canada. Habitat destruction, recreational activities, and pollution contribute to the threat to its population. #Canada150 #Biodiversity150

Specimen CCDB-23395-A02 – Ontario, Canada – 13-Sep-1989. Photo Credit: Agriculture and Agri-Food Canada
Engelmann’s quillwort at the edge of a shallow pond. Photo Credit: W. Carl Taylor, hosted by the USDA-NRCS PLANTS Database / USDA NRCS. 1995. Northeast wetland flora: Field office guide to plant species. Northeast National Technical Center, Chester.
Engelmann’s quillwort found in a river valley. Photo Credit: Alan Cressler goo.gl/t34fqJ

Here’s the barcode sequence information for this species:

Process ID: VASCB002-15

nucleotide sequence

GAGTGTTGGATTCAAAGCTGGCGTTAAAGATTACAGATTAAATTATTATACTCCTGATTATAAGACCAAAGACACCGATATTCTGGCAGCATTCCGAATGACTCCCCAACCCGGAGTACCACCTGAGGAAGCAGGAGCCGCAGTAGCTGCTGAATCTTCCACCGGTACATGGACCACTGTCTGGACCGATGGACTTACTAGCCTTGATCGTTACAAAGGTCGATGCTATGACATCGAACCCGTTGCTGGAGAAGAAAATCAATATATTGCCTATGTAGCTTATCCTTTGGATCTGTTCGAGGAAGGTTCTGTTACTAACATGTTCACTTCCATTGTAGGTAATGTATTTGGATTTAAAGCCTTACGAGCTCTACGTTTGGAAGATTTGCGAATTCCTCCTGCATATTCCAAAACCTTCCAAGGTCCACCTCACGGTATCCAAGTTGAAAGAGATAAATTGAACAAATATGGTCGTCCTTTATTGGGATGTACTATTAAACCGAAATTAGGTTTATCCGCTAAAAACTACGGTAGAGCAGTGTATGAATGTCTT

amino acid sequence

SVGFKAGVKDYRLNYYTPDYKTKDTDILAAFRMTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEPVAGEENQYIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL

Visual representation of DNA barcode sequence for Engelmann's Quillwort

109/150: This little brown bat may be gone soon! That means more mosquitoes biting you!

Posted on by Jaclyn McKeown
Animalia: Chordata: Mammalia: Chiroptera: Vespertilionidae: Myotinae: Myotis: Myotis lucifugus (LeConte, 1831)

The little brown bat (Myotis lucifugus) was once a common species around North America but is now considered Endangered and protected federally in Canada under the Species at Risk Act. The little brown bats are insectivores that are 6-10 cm long, weigh 5-14 grams and live for 6 to 7 years. They are nocturnal and can be found roosting in attics and barns during the summer months and in winter they hibernate in caves or mines. Continue reading “109/150: This little brown bat may be gone soon! That means more mosquitoes biting you!” →