132/150: What’s green, marine and a potential killing machine? Sea Lettuce!

Plantae: Chlorophyta: Ulvophyceae: Ulvales: Ulvaceae: Ulva: Ulva lactuca Linnaeus 1753

Although it resembles terrestrial salad greens, Ulva lactuca (sea lettuce) is a species of aquatic green algae. The bright green ruffled edge “leaves” are composed of 2 layers of cells, found free floating or attached to surfaces in areas with exposed rocks and tide pools. Ulva lactuca is edible, and can be added to salads or soups, or used in medicine. However, this nutritious chlorophyte has a dark side. When large concentrations of sea lettuce die, the rotting algae uses up large amounts of oxygen, potentially suffocating other aquatic species (eutrophication). When large quantities of the rotting algae washes up on shore, it produces toxic hydrogen sulfide gas, which can be a public safety risk. Although it can be tolerated in low doses, short term high exposure to fumes by unlucky beachgoers has led to documented cases of collapse, loss of breathing and even death! Watch out for killer lettuce! #Canada150 #Biodiversity150

The humble sea lettuce, a type of algae. Photo Credit: H. Krisp goo.gl/4sX6HV
Sea lettuce washed up on a beach. Photo Credit: Ecomare/Oscar Bos goo.gl/fr9UUZ
A SEA of Sea Lettuce! Photo Credit: Ria Tan goo.gl/TPWMwZ

Here’s the barcode sequence information for this species:

Process ID: ULVA558-09

nucleotide sequence

CGTGATCGTTTCTTATTTGTTGCTGAAGCAATTTATAAATCTCAATCTGAAACTGGTGAGGTGAAAGGACATTACTTAAATGCAACAGCAGGTACATGTGAAGAAATGATGGAACGTGGTCAATTTGCTAAAGATTTAGGTGTTCCAATTGTTATGCATGACTATATTACTGGTGGTTTTACAGCTAACACTTCATTATCTCGTTTCTGTCGTGCTAGTGGATTATTATTACATATTCACCGTGCTATGCACGCTGTTATTGATCGTCAACGTAATCACGGTATTCACTTCCGAGTATTAGCGAAAATTTTACGTATGTCAGGTGGTGACCACTTACACTCAGGAACAGTAGTAGGTAAATTAGAAGGTGAACGTGAAATTACTTTAGGTTTCGTTGACTTAATGCGTGATGACTACATTGAAAAAGATCGTAGTCGTGGTATTTACTTTACTCAAGATTGGGTTAGTTTACCTGGTACAATGCCTGTAGCGTCAGGTGGTATTCACGTGTGGCACATGCCTGCATTAGTTGAAATCTTTGGTGATGATGCATGTTTACAATTCGGTGGTGGTACATTAGGACACCCTTGGGGTAACGCTCCAGGAGCCGCTGCAAACCGTGTAGCTTTAGAAGCTTGTACACAAGCCCGAAACGAAGGGCGTGATTTAGCGTCTGAAGGCGGTGATGTAATTCGTGCTGCTTGTAAATGGAGTCCTGAATTAGCTGCAGCTTGT

amino acid sequence

RDRFLFVAEAIYKSQSETGEVKGHYLNATAGTCEEMMERGQFAKDLGVPIVMHDYITGGFTANTSLSRFCRASGLLLHIHRAMHAVIDRQRNHGIHFRVLAKILRMSGGDHLHSGTVVGKLEGEREITLGFVDLMRDDYIEKDRSRGIYFTQDWVSLPGTMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAANRVALEACTQARNEGRDLASEGGDVIRAACKWSPELAAAC

Visual representation of DNA barcode sequence for Sea lettuce

10/150: Have you ever eaten red algae? We bet you have!

Plantae: Rhodophyta: Florideophyceae: Ceramiales: Wrangeliaceae: Ptilota: Ptilota serrata (Kützing, 1847)

Red algae (Phylum Rhodophyta) are a diverse group of plants with over 7,000 species known and we have DNA barcodes for over 3,000 of them. Ptilota serrata, the Northern Sea Fern is a common red algae found on the Pacific, Arctic, and Atlantic coasts of Canada. Continue reading “10/150: Have you ever eaten red algae? We bet you have!”