124/150: Good Indicators of Water Quality, True Facts about the Fishfly

Animalia: Arthropoda: Insecta: Megaloptera: Corydalidae: Nigronia serricornis (Say 1824)

Nigronia serricornis is neither a fish nor a fly, instead falling in the insect order Megaloptera (including both Fishflies, Alderflies and Dobsonflies or Hellgrammites). Females lay eggs in masses near open fast flowing water. Larvae are aquatic and predatory, feeding on insects and worms with their strong mandibles. Larvae grow slowly, taking up to 3 years to reach the final larval stage. When mature, larvae crawl onto land to pupae in soil or in rotting logs at the edge of streams, keeping their mandibles exposed for defense. The adults are dark brown, up to 5 cm long, with large wings that make them very clumsy fliers. Adults are typically non-feeding and live for up to a week, spotted flying around streams or around porch lights. Fishfly larvae only live in clear clean water, so they are commonly used as an environmental indicator species of very good water quality. #Canada150 #Biodiversity150

Adult specimen BBMEG045-10 -Manistee National Forest, Pines Point, Michigan, United States. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Larval specimen ECCAC004-09 -York County, New Brunswick, Canada. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics

Here’s the barcode sequence information for this species:

Process ID: SWCHL586-15

nucleotide sequence

AACTCTTTATTTTCTCTTTGGTGCTTGGTCAGGTATAGTTGGAACATCACTTAGTTTATTAATTCGGGCTGAATTAGGGCAACCTGGTTCATTAATTGGAGATGATCAAATTTATAATGTTATTGTAACAGCTCATGCATTTGTAATAATTTTTTTTATAGTAATACCTGTAATAATTGGGGGGTTTGGAAATTGATTAGTCCCTTTAATATTAGGGGCCCCCGATATAGCATTTCCTCGAATAAATAATATAAGTTTTTGACTTCTTCCTCCTTCATTAACCCTACTTTTATCAAGCTCTTTCGTTGAAAGAGGAGCAGGAACAGGATGAACCGTTTACCCTCCATTAGCTTCTGGGATTGCCCATGCTGGAGCTTCTGTAGATTTAGCTATTTTTAGCCTTCATTTAGCGGGGGTATCATCAATTTTAGGGGCAGTTAATTTCATTACTACAGTTATTAATATACGATCTCCTGGAATAACTTTTGACCGAATACCTTTATTTGTCTGATCTGTCGCAATTACAGCCCTGCTCCTTCTTTTATCTCTCCCTGTTCTTGCTGGAGCTATTACAATACTTTTAACTGATCGTAATTTAAATACATCATTTTTTGACCCTGCCGGAGGAGGTGACCCAATTCTATACCAACATTTATTT

amino acid sequence

TLYFLFGAWSGMVGTSLSLLIRAELGQPGSLIGDDQIYNVIVTAHAFVMIFFMVMPVMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLSSSFVESGAGTGWTVYPPLASGIAHAGASVDLAIFSLHLAGVSSILGAVNFITTVINMRSPGMTFDRMPLFVWSVAITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Megaloptera

Learn more about it’s BIN (Barcode Index Number): BOLD:AAA1274

53/150: If you think adulting is hard as a human, try it as a mayfly where you only have a single day to reproduce!

Animalia: Arthropoda: Insecta: Ephemeroptera: Siphlonuridae: Siphlonurus: Siphlonurus alternatus (Say, 1824)

The great Carl Sagan once said that “Compared to a star, we are like mayflies, fleeting ephemeral creatures who live out their lives in the course of a single day”. While this is indeed true for adult mayflies, whose order classification “Ephemeroptera” is coined from the term ephemeral, it is not entirely accurate. Continue reading “53/150: If you think adulting is hard as a human, try it as a mayfly where you only have a single day to reproduce!”

27/150: The small priceless gems of freshwater ecosystems

Animalia: Arthropoda: Malacostraca: Amphipoda: Hyalellidae: Hyalella: Hyalella azteca (Saussure, 1858)

Amphipods are common crustaceans that are found in freshwater bodies such as lakes and rivers and Hyalella azteca is one of the most abundant in North America. Due to their small size, these animals mainly feed on diatoms, algae and organic detritus. Continue reading “27/150: The small priceless gems of freshwater ecosystems”