#Biodiversity150 number 104 of 150 Pubic lice

104/150: Feeling crabby about pubic lice?

Animalia: Arthropoda: Insecta: Psocodea: Pthiridae: Pthirus: Pthirus pubis (Linnaeus, 1758)

Humans host three types of lice, which are wingless and unable to jump so they spend their entire lifecycle on the host. The pubic louse, a blood sucking parasite that lives exclusively on humans, can thrive anywhere on the body with coarse hair, such as in beards or the eyelashes. The head and body louse share a common ancestor with a louse found on chimpanzees while the pubic louse shares an ancestor with the gorilla louse. Due to the evolutionary separation, pubic lice are very easy to distinguish from the head and body lice. They have a rounded but flattened body while the other lice are elongated, and their two pairs of rear legs are enlarged and have strong claws for gripping the hairs. This appearance has earned the pubic louse the other common name “crab louse.” Lice can spread to other human hosts via physical contact or infested clothing. #Canada150 #Biodiversity150

Adult pubic louse. Photo Credit: Kauczuk goo.gl/cyL75C
Head louse compared to pubic louse. Photo Credit: Public Health Image Library goo.gl/3KyB45

Here’s the barcode sequence information for this species:

Process ID: GBMH6652-09

nucleotide sequence

————————————————————————————————————————————————————————————————————————————————TTAGTTCCTTTA—TTTTTAGGTGCTCCTGACATGGCTTTCCCCCGGATGAACAATATAAGCTATTGGCTGATTATGCCCTCTGGGGTTCTGTTAATTGCGAGTTCAATAATCCAAGGTGGAACAGGTACTGGCTGGACTATTTATCCTCCGCTAAGTTCTTTAGAAGGCCAACCTTCTTTATCAGTGGATTTT—ACCATCTTTAGCCTCCATTTAGCTGGAGTAAGTTCTATTTTAGGCTCAGTAAATTTTATTAGGACAATTTTAAATATATGACCTTCTAGGTTAAAGATTTACCGGTTACCTTTGTTCTGCTGGTCTGTCTTAATCACGGCCTTTTTGCTTCTACTCTCTTTACCTGTACTTGCGGGT—GCTATCACTATGCTACTATTAGATCGGAATTTTAATTGTTCTTTTTTTGACCCTCTAGGTGGAGGTGATCCTGTTCTTTACCAGCATCTTTTTTGGTTTTTTGGTCATCCTGAGGTTTATATCTTGATCTTACCTGGGTTTGGATTGATCTCTCATATGGTTGTTGACTTGAGAGGTAAGAAA—GAAGTCTTTGGTTCATTAGGAATAATCTACGCTATAGTATCGATTGGTGTTCTAGGGTTTGTTGTTTGAGCCCACCACATGTTCACTGTTGGTCTAGATGTAGATAGACGTGCTTACTTTACTAGAGCTACTATGACCATTGCTATTCCAACGGGAGTAAAAGTCTTTAGCTGATTAGGT—ACTCTATTTGGCCCT—AAACTTCACTTAAGAGTGAGGTTGCAGTGGTCTCTGGGATTCATCTTTTTATTTACTGTTGGAGGCCTGACAGGGATTATTCTATCTAACTCGTCAGTTGACGTTCTTCTT————————————————————————————————————————————————————————————————————————————————————————————————————————————————————————————————

amino acid sequence

LVPL-FLGAPDMAFPRMNNMSYWLIMPSGVLLIASSMIQGGTGTGWTIYPPLSSLEGQPSLSVDF-TIFSLHLAGVSSILGSVNFISTILNMWPSSLKIYRLPLFCWSVLITAFLLLLSLPVLAG-AITMLLLDRNFNCSFFDPLGGGDPVLYQHLFWFFGHPEVYILILPGFGLISHMVVDLSGKK-EVFGSLGMIYAMVSIGVLGFVVWAHHMFTVGLDVDSRAYFTSATMTIAIPTGVKVFSWLG-TLFGP-KLHLSVSLQWSLGFIFLFTVGGLTGIILSNSSVDVLL——————————————————————————————————————————–

Visual representation of DNA barcode sequence for Pubic lice

Learn more about it’s BIN (Barcode Index Number): BOLD:AAD2987


Comments

Leave a Reply

Your email address will not be published. Required fields are marked *