#Biodiversity150 number 106 of 150 Western Flower Thrips

106/150: Thrips are tiny insects with big agricultural implications

Animalia: Arthropoda: Insecta: Thysanoptera: Thripidae: Thripinae: Frankliniella: Frankliniella occidentalis (Pergande, 1895)

Western flower thrips belong to the order Thysanoptera. These insects are very small (~1mm long) and elongated with long thin wings fringed with hairs. Like true bugs, they have small piercing and sucking mouthparts on the underside for feeding on plant tissue. Thrips impact many agricultural crops as they feed on the fruit of numerous plants such as apples, plums, apricots, potatoes, and alfalfa. Because these insects spend only a couple weeks developing into adults, there are overlapping generations living and feeding on the host plants, which can lead to large numbers of these insects, causing a decline in the quality of the fruits. There are some beneficial insects that prey on thrips such as minute pirate bugs and green lacewing larvae. There are 403 western flower thrips with barcodes on BOLD. #Canada150 #Biodiversity150

Specimen 10BBTHY-0127 – Redstreak Campground, Kootenay National Park, British Columbia – 30-Jul-2010. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Western flower thrip (on right) compared to onion thrip (on left). Photo Credit: Alton N. Sparks Jr. goo.gl/THF4su
Suocerathrips linguis feeding on plant tissue. Western flower thrips cause similar damage to fruits. Photo Credit: PaulT goo.gl/GxNHPS

Here’s the barcode sequence information for this species:

Process ID: BBTHW007-10

nucleotide sequence

AATTTTATATTTTTTATTTGGATTTTGATCAGGTATATTTGGTTTATCATTAAGTATATTAATCCGATTAAACTTACGAACATCTTTTAAACTATTTATTAGAAATGACCAATTTTATAATTCAGTAGTAACAGCCCATGCATTCGTAATAATTTTTTTTACAGTTATACCAATTATAATTGGTGGGTTTGGTAATTGATTAGTACCTTTAATATTAGGAGCCCCAGATATAGCATTTCCTCGACTTAATAATATAAGATTTTGACTTCTTCCACCCTCTTTAACATTGTTAATCATAGG—TTTATCAAAGGATGGTGCAGGAACAGGATGAACGGTTTACCCACCTTTATCAACTTTTTATCACTCTGGACCATCAGTAGATTTAACTATTTTTTCTCTTCATTTGGCAGGTATTTCCTCAATTTTAGGGGCTTTAAACTTTATTACAACAATTTTAAATTTAAAAATCAAAAAGTTAACAACGGAAAAGATAACTTTATTTGTTTGATCAGTTATTTTAACAGCTATTTTATTATTACTGTCATTACCAGTTTTAGCAGGAGCTATTACAATATTATTAACGGACCGAAACTTAAACACATCCTTCTTTGATCCGAGAGGAGGTGGGGACCCAGTTTTATACCAACACTTGTTT

amino acid sequence

ILYFLFGFWSGMFGLSLSMLIRLNLRTSFKLFISNDQFYNSVVTAHAFVMIFFTVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLIMXXLSKDGAGTGWTVYPPLSTFYHSGPSVDLTIFSLHLAGISSILGALNFITTILNLKIKKLTTEKMTLFVWSVILTAILLLLSLPVLAGAITMLLTDRNLNTSFFDPSGGGDPVLYQHLF

Visual representation of DNA barcode sequence for Western Flower Thrips

Learn more about it’s BIN (Barcode Index Number): BOLD:ACZ4231


Comments

Leave a Reply

Your email address will not be published. Required fields are marked *