Animalia: Arthropoda: Insecta: Thysanoptera: Thripidae: Thripinae: Frankliniella: Frankliniella occidentalis (Pergande, 1895)
Western flower thrips belong to the order Thysanoptera. These insects are very small (~1mm long) and elongated with long thin wings fringed with hairs. Like true bugs, they have small piercing and sucking mouthparts on the underside for feeding on plant tissue. Thrips impact many agricultural crops as they feed on the fruit of numerous plants such as apples, plums, apricots, potatoes, and alfalfa. Because these insects spend only a couple weeks developing into adults, there are overlapping generations living and feeding on the host plants, which can lead to large numbers of these insects, causing a decline in the quality of the fruits. There are some beneficial insects that prey on thrips such as minute pirate bugs and green lacewing larvae. There are 403 western flower thrips with barcodes on BOLD. #Canada150 #Biodiversity150
Here’s the barcode sequence information for this species:
Process ID: BBTHW007-10
nucleotide sequence
AATTTTATATTTTTTATTTGGATTTTGATCAGGTATATTTGGTTTATCATTAAGTATATTAATCCGATTAAACTTACGAACATCTTTTAAACTATTTATTAGAAATGACCAATTTTATAATTCAGTAGTAACAGCCCATGCATTCGTAATAATTTTTTTTACAGTTATACCAATTATAATTGGTGGGTTTGGTAATTGATTAGTACCTTTAATATTAGGAGCCCCAGATATAGCATTTCCTCGACTTAATAATATAAGATTTTGACTTCTTCCACCCTCTTTAACATTGTTAATCATAGG—TTTATCAAAGGATGGTGCAGGAACAGGATGAACGGTTTACCCACCTTTATCAACTTTTTATCACTCTGGACCATCAGTAGATTTAACTATTTTTTCTCTTCATTTGGCAGGTATTTCCTCAATTTTAGGGGCTTTAAACTTTATTACAACAATTTTAAATTTAAAAATCAAAAAGTTAACAACGGAAAAGATAACTTTATTTGTTTGATCAGTTATTTTAACAGCTATTTTATTATTACTGTCATTACCAGTTTTAGCAGGAGCTATTACAATATTATTAACGGACCGAAACTTAAACACATCCTTCTTTGATCCGAGAGGAGGTGGGGACCCAGTTTTATACCAACACTTGTTT
amino acid sequence
ILYFLFGFWSGMFGLSLSMLIRLNLRTSFKLFISNDQFYNSVVTAHAFVMIFFTVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLIMXXLSKDGAGTGWTVYPPLSTFYHSGPSVDLTIFSLHLAGISSILGALNFITTILNLKIKKLTTEKMTLFVWSVILTAILLLLSLPVLAGAITMLLTDRNLNTSFFDPSGGGDPVLYQHLF
Learn more about it’s BIN (Barcode Index Number): BOLD:ACZ4231
Leave a Reply