#Biodiversity150 number 112 of 150 Tamarack Tree

112/150: Autumn is here and the Tamarack Tree loses its needles

Plantae: Pinophyta: Pinidae: Pinales: Pinaceae: Larix: Larix laricina (Du Roi) K. Koch

From the Algonquin word “akemantak” meaning “wood used for snowshoes”, tamarack is a native larch to Canada with a country-wide range. Tamarack are deciduous conifers, meaning they lose their needles in the autumn! Their needles tend to turn a brilliant yellow before they fall, making tamarack a wonderful landscape tree. These hardy trees able to withstand a wide range of environmental conditions such as cold temperatures and poor soil, and are typically pioneer invaders in burn sites. Tamarack has great historic significance due to its durability and flexibility. Not only was it cut into strips for snowshoes, but it was also used medicinally in the form of poultices (pulp), tea (needles), and sap (resin). Today, tamaracks are most commonly used ornamentally, either planted in gardens or grown as bonsai. #Canada150 #Biodiversity150

Specimen MT00180133 – Parc agricole du Bois-de-la-Roche, Quebec – 18-Jun-2012. Photo Credit: Universite de Montreal, L’Herbier Marie-Victorin
Needles of the tamarack. Photo Credit: Andree Reno Sanborn goo.gl/CPYdE7
Tamarack needles changing colour in early autumn. Photo Credit: Subi Wilks goo.gl/dPpz61

Here’s the barcode sequence information for this species:

Process ID: MKPCH145-09

nucleotide sequence

AGTGTCGGATTCAAAGCTGGTGTTAAAGATTACAGATTAACTTATTATACTCCTGAATATCAGACCAAAGATACGGATATCTTGGCAGCATTCCGAGTAACTCCTCAACCTGGGGTGCCACCCGAGGAAGCGGGAGCAGCAGTAGCTGCTGAATCTTCCACCGGTACATGGACCACTGTTTGGACCGATGGACTTACTAGTCTTGATCGTTACAAGGGACGATGCTATGACATCGAGGCCGTTCCTGGAGAGGAGAGTCAATTTATTGCCTATGTAGCTTACCCCTTAGACCTTTTCGAAGAAGGTTCTGTTACTAACTTGTTCACTTCCATTGTAGGTAATGTATTTGGATTCAAGGCCCTACGGGCTCTACGTTTGGAAGATTTGCGGATCCCCCCTGCTTATTCCAAAACTTTTCAAGGTCCACCTCATGGTATCCAAGTCGAAAGGGATAAATTGAACAAATATGGCCGTCCTTTATTGGGATGTACTATCAAACCAAAATTGGGTCTATCGGCTAAGAACTATGGTAGAGCAGTTTACGAATGTCTC

amino acid sequence

SVGFKAGVKDYRLTYYTPEYQTKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYDIEAVPGEESQFIAYVAYPLDLFEEGSVTNLFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL

Visual representation of DNA barcode sequence for Tamarack Tree

 

Leave a Reply

Your email address will not be published.