Animalia: Arthropoda: Insecta: Coleoptera: Lampyridae: Photuris quadrifulgens (Barber, 1951)
Photuris quadrifulgens is a species in the beetle family Lampyridae, commonly known as the fireflies. This species belongs to the femme fatale lightning bugs that produce light flashes from lantern organs on their abdomen.The majority of fireflies use this flashing pattern as a form of communication to help attract potential mates. Interestingly this genus has developed the capability to mimic the flash pattern of other firefly species resulting in the females attracting eager males for mating. Unfortunately for the males, the females are not looking for a partner, but rather a meal to devour. Not only do they eat their prey for nutrition, but they also obtain their defensive chemicals for protection. Talk about a bad date! #Canada150 #Biodiversity150
Here’s the barcode sequence information for this species:
Process ID: BBCCM478-10
nucleotide sequence
GACATTATATTTTATTTTTGGTGCTTGATCAGGAATATTAGGAACTTCTTTAAGATTATTAATTCGAGCAGAATTAGGAAGACCTGGATCCTTAATTGGAAATGATCAAATTTTTAATGTTATTGTAACAGCTCACGCTTTCATTATAATTTTCTTTATAGTAATACCAGTAATAATTGGAGGATTTGGAAATTGACTAGTACCCCTAATACTTGGTGCCCCTGATATAGCCTTCCCCCGAATAAATAATATAAGATTTTGACTGTTACCTCCCTCTATTACCCTTCTTTTAATAAGAAGAATAGTTGAAAGAGGAGCCGGTACTGGTTGAACTGTTTACCCCCCATTATCTGCTAATTTAGCTCATAGAGGGGCATCTGTTGATTTAGCTATTTTTAGATTACATTTAGCTGGAATTTCTTCAATTTTAGGTGCAGTAAATTTTATTTCAACTATTGCTAATATACGACCAATTGAAATAAAGCTCGACCAAATACCTTTATTTGTTTGAGCTGTTCTTATTACAGCTGTACTTTTACTTTTATCCCTACCAGTTTTAGCTGGAGCTATTACTATGTTATTAACTGACCGTAATTTAAATTCTTCATTCTTTGATCCAGCAGGAGGTGGAGATCCAATTTTATATCAACATTTATTT
amino acid sequence
TLYFIFGAWSGMLGTSLSLLIRAELGSPGSLIGNDQIFNVIVTAHAFIMIFFMVMPVMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSITLLLMSSMVESGAGTGWTVYPPLSANLAHSGASVDLAIFSLHLAGISSILGAVNFISTIANMRPIEMKLDQMPLFVWAVLITAVLLLLSLPVLAGAITMLLTDRNLNSSFFDPAGGGDPILYQHLF
Learn more about it’s BIN (Barcode Index Number): BOLD:AAF6064
Leave a Reply