129/150: Brittle stars know how to get around!
Animalia: Echinodermata: Ophiuroidea: Ophiurida: Ophiactidae: Ophiopholis: Ophiopholis aculeata (Linnaeus, 1767)
The daisy or crevice brittle star, Ophiopholis aculeata, is one of many species of brittle stars that live in Canadian waters. A circumpolar species, these echinoderms are recognizable by their long, thin arms, quite distinct from their central plate. Unlike other sea stars, brittle stars do not use their tube feet for locomotion, but instead use wriggling movements of their whole arms to move. Despite being a radially symmetrical animal, brittle star locomotion is much like a bilaterally symmetrical animal – choosing a lead arm and then using paired movements of their other arms (almost like rowing) to move themselves. These arms are connected to the central disc with a ball and socket type joint – much like our shoulders, giving brittle stars an incredible amount of flexibility! #Canada150 #Biodiversity150



Here’s the barcode sequence information for this species:
Process ID: DSPEC124-07
nucleotide sequence
AACACTATACTTTATATTTGGTGCCTGAGCAGGTACAGTAGGGACTGCCATGAGAAAAATTATACGAGTTGAACTTTCTCAGCCAGGCTCTTTAATACAAGATGATCAAGTGTATAAAGTTATGGTAACGGCCCACGCCTTCGTGATGATATTTTTTATGGTAATGCCCATAATGATAGGGGGGTTTGGCAAATGACTTGTCCCACTAATGTTAGGAGCGCCTGATATGGCTTTCCCCCGAATGAAAAAAATGAGATTTTGGCTACTACCCCCAGCTTTTATACTTCTTCTAGCTTCAGCTGCAAACGAAGGAGGAGTAGGCACTGGATGAACTGTTTATCCCCCTTTGTCAGGCCCTACCGCACATGCAGGAGGCTGCGTAGACCTCGCAATTTTTTCTCTCCACCTAGCAGGTGCATCTTCAATTATGGCCTCAATAAAATTTATTACAACTATTATAAATATGCGTAGGCCCGGCATGACCATGGATCGACTTCCGCTTTTTGTTTGATCTATTTTCTTAACAACTATATTACTACTCCTTTCTCTGCCTGTTTTAGCAGGAGCTATTACAATGCTACTAACTGATCGTAACATAAAAACAACGTTTTTTGATCCTACAGGAGGAGGAGACCCAATACTTTTCCAACATTTATTT
amino acid sequence
TLYFIFGAWAGTVGTAMSNIIRVELSQPGSLIQDDQVYNVMVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPAFILLLASAANEGGVGTGWTVYPPLSGPTAHAGGCVDLAIFSLHLAGASSIMASINFITTIINMRSPGMTMDRLPLFVWSIFLTTILLLLSLPVLAGAITMLLTDRNINTTFFDPTGGGDPILFQHLF
Learn more about it’s BIN (Barcode Index Number): BOLD:AAA9003