#Biodiversity150 number 134 of 150 Ferruginous Hawk

134/150: A soaring hawk of the prairies

Animalia: Chordata: Aves: Accipitriformes: Accipitridae: Buteo: Buteo regalis (Gray, 1844)

The Ferruginous Hawk is the largest hawk native to North America and is a specialist predator, feeding on specific rodent species. It is classified as Threatened by the Committee on the Status of Endangered Wildlife in Canada (COSEWIC) due to the loss and fragmentation of its breeding habitat, the prairies of Canada. With an estimated population of 1200 breeding pairs, efforts are being made to reduce habitat loss.

Hawk refers to diurnal (active by day) predatory birds. Hawks are considered among the most intelligent birds, as having one of the best eyesight in the animal kingdom (eight times better than us!). They can see ultra-violet light and can detect polarized light or magnetic fields. Hawks can reach diving speeds of over 240 km an hour and undertake long migrations, travelling thousands of miles a year. Hawk couples are monogamous, usually mating for life.  #Canada150 #Biodiversity150

The Ferruginous Hawk (Buteo regalis). Photo Credit: Tony Hisgett goo.gl/LbKqFD
The Ferruginous Hawk, looking fierce. Photo Credit: Tim Sträter goo.gl/2NcyZY
A Ferruginous Hawk perched on a fence. Photo Credit: Dick Daniels goo.gl/iGWyAn
A Ferruginous Hawk soaring through the sky. Photo Credit: Shravans14 goo.gl/e9CWvc

Here’s the barcode sequence information for this species:

Process ID: KBNA789-04

nucleotide sequence

CCTATACCTAATCTTCGGTGCCTGAGCCGGTANAGTCGGCACCGCCCTCAGCCTACTTATTCGCGCAGAACTCGGCCAACCAGGCACACTCCTAGGTGATGACCAGATCTACAACGTAATCGTTACCGCACATGCCTTCGTAATAATTTTCTTTATAGTTATACCAATTATGATCGGAGGCTTCGGAAACTGACTTGTTCCACTCATAATCGGCGCCCCCGACATAGCCTTCCCACGCATAAACAACATAAGCTTCTGACTACTTCCTCCATCCTTTCTCCTCCTCCTAGCCTCCTCAACAGTAGAAGCAGGAGCTGGCACTGGATGAACTGTCTATCCCCCACTAGCTGGTAACATAGCCCATGCCGGAGCTTCAGTAGACCTAGCTATCTTCTCCCTACACTTAGCCGGAGTCTCGTCCATTCTAGGAGCAATCAACTTTATCACAACCGCCATCAACATAAAGCCCCCAGCTCTCTCCCAATATCAAACACCCCTATTCGTATGATCTGTCCTCATTACCGCTGTCCTTCTACTACTTTCACTCCCAGTCCTAGCCGCCGGCATTACCATACTACTTACAGACCGAAACCTAAACACAACATTCTTTGACCCCGCCGGCGGAGGTGACCCCATCCTATACC

amino acid sequence

LYLIFGAWAGXVGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLAGNMAHAGASVDLAIFSLHLAGVSSILGAINFITTAINMKPPALSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYX

Visual representation of DNA barcode sequence for Ferruginous Hawk

Learn more about it’s BIN (Barcode Index Number): BOLD:ABZ1637

Leave a Reply

Your email address will not be published.