#Biodiversity150 number 136 of 150 Atlantic whitefish

136/150: Poach Eggs Not Whitefish

Animalia: Chordata: Actinopterygii: Salmoniformes: Salmonidae: Coregonus: Coregonus huntsmani (W. B. Scott, 1987)

The Atlantic whitefish (Coregonus huntsmani), is native to Nova Scotia, Canada residing in the Tusket River and Petite Riviere. If you see this species, consider yourself lucky. In 1970, under the federal Fisheries Act, the fishing for the species was prohibited. Habitat loss from the damming of the Tusket River contributed to its decline as well as introduced fish species. To this day, it is still considered endangered. The Atlantic whitefish has silver coloured sides and a darkish blue-green back, spawns in freshwater and lives out most of its life in the sea. Its diet consists of amphipods, periwinkles and marine worms. #Canada150 #Biodiversity150

The Atlantic whitefish (Coregonus huntsmani), an endangered species. Photo Credit: Department of Fisheries and Oceans Canada goo.gl/x8k8Ca
Range of the Atlantic whitefish. Photo Credit: Government of Canada goo.gl/GZy7UT

Here’s the barcode sequence information for this species:

Process ID: BCFB943-07

nucleotide sequence

CCTTTATTTAGTATTTGGTGCCTGAGCCGGAATAGTCGGCACAGCCCTAAGCCTTTTAATCCGAGCGGAGCTAAGCCAACCCGGGGCTCTTCTAGGGGATGATCAGATTTATAATGTAATCGTCACGGCCCATGCCTTCGTTATGATTTTCTTTATAGTTATGCCAATTATGATTGGAGGCTTTGGAAACTGATTAATCCCACTTATAATTGGGGCCCCCGACATGGCATTTCCCCGAATGAACAACATGAGCTTTTGGCTCCTTCCCCCATCCTTTCTCCTTCTCCTGGCCTCGTCCGGAGTTGAAGCCGGTGCCGGCACAGGATGAACAGTCTACCCCCCTCTGGCAGGCAACCTCGCCCACGCAGGGGCCTCCGTCGATTTAACTATTTTCTCCCTCCACCTAGCTGGTATTTCCTCTATCTTGGGAGCCGTTAATTTTATTACAACCATTATTAATATGAAACCCCCAGCTATTTCCCAGTATCAAACCCCCCTGTTTGTTTGAGCCGTCTTAATTACCGCAGTCCTCTTACTGCTCTCCCTTCCTGTCCTAGCAGCAGGTATTACCATGCTACTCACAGACCGAAATCTAAACACCACTTTCTTTGACCCAGCAGGCGGGGGAGATCCAATCCTGTATCAACACCTC

amino acid sequence

LYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISSILGAVNFITTIINMKPPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL

Visual representation of DNA barcode sequence for Atlantic Whitefish

Learn more about it’s BIN (Barcode Index Number): BOLD:AAI9334


Comments

Leave a Reply

Your email address will not be published. Required fields are marked *