149/150: Not your typical song scales
Animalia: Arthropoda: Insecta: Hemiptera: Sternorrhynncha: Coccoidea: Diaspididae: Quadraspidiotus: Quadraspidiotus perniciosus (Comstock, 1881)
Scale bugs are some pesky critters. Belonging to the order Hemiptera, they have a defining beak like characteristic used to suck out the contents of its prey. The females are typically immobile and have a waxy scale like surface whereas the males have one set of functioning forewings and suppressed hindwings. These insects will not harm you, but they will harm our agricultural crops. A word of advice: don’t use insecticides to kill them because their waxy coatings provide protection. Use systemic pesticides or oils. The San Jose scale is an example pest of our beloved orchard fruits! The pest is known for feasting on fruits such as apples, plums and pears. Living on the blossom and stem sides, the San Jose scale injects toxic fluids leaving blemishes. #Biodiversity150 #Canada150


Here’s the barcode sequence information for this species:
Process ID: CNPPJ1172-12
nucleotide sequence
——————————————————————————————————————————————————————————————————————————————————————ATTTTGATTTTTATTTCCATCATTAATATTAATAATTTTTAATTTATTAATTAATGATAATATTAATACAGGATGAACATTATACCCTCCATTAATTAAT———CAAAATAATTCATCAATTAATTTTATTATTTTTTCTTTACATATAAATGGTATTTCTTCAATTTTGAGATCAATAAATTTTATATTAACAATAATCTATTTAAAATCATTCAATTCAAATTTATTAAATTTAAATTTATTTTGCTGATCTATCATAATCACATCAATATTATTAATTTTATCTTTACCTGTATTAGCTAGTGGAATTACAATAACACTAGCA———GATATTAATTTTAAAACAATATTTTTCAATCCAAGAGGAAATGGTAATCCTATTTTATTCCAACATTTATTT—
amino acid sequence
FWFLFPSLMLMIFNLLINDNINTGWTLYPPLIN—QNNSSINFIIFSLHMNGISSILSSMNFMLTMIYLKSFNSNLLNLNLFCWSIMITSMLLILSLPVLASGITMTLA—DINFKTMFFNPSGNGNPILFQHLF-
Learn more about it’s BIN (Barcode Index Number): BOLD:AAI6713