Animalia: Arthropoda: Collembola: Symphypleona: Sminthuridae: Allacma: Allacma fusca (Linnaeus, 1758)
Allacma fusca is a species of globular springtail (Collembola) originally found in western continental Europe and the British Isles. Most globular springtails have a unique and rather strange mating ritual compared to their plump springtail and slender springtail relatives. While facing each other, a male globular springtail will use his modified antennae to grip the female by her antennae. The female then shakes him around in the air until his sperm is released onto the ground – now called the “spermatophore“. The males will then attempt to drag the female to the spermatophore so she can take it up into her body. It can often be difficult for the males to do this as they are usually smaller than the females! 195 barcodes of this species are on BOLD. #Canada150 #Biodiversity150
Check out this cool video of their mating ritual!
Here’s the barcode sequence information for this species:
Process ID: GMFIF579-12
nucleotide sequence
AACCCTATATCTTATTATAGGTGTTTGATCAGCAATAGTTGGGACGGCCTTTAGAGTCCTAATTCGACTTGAATTGGGACAACCGGGTAGCCTAATTGGAAATGATCAAATCTACAATGTTCTAGTCACATCACACGCCTTCATTATGATTTTCTTCATAGTTATACCAATTATAATCGGAGGATTCGGAAATTGGCTAGTTCCAATAATAATCGGAGCCCCTGATATAGCTTTCCCTCGAATAAATAACATAAGATTCTGACTTCTACCTCCAGCATTAACCCTTCTTTTAATAGGGGCCGCGGTAGAAAGGGGGGCAGGTACTGGATGAACAGTCTACCCTCCTTTAGCATCTTCAGTAGCACACTCAGGAGCCTCAGTTGATTTAACTATTTTTAGCCTTCATCTTGCAGGGATTTCATCAATTCTAGGGGCCATCAATTTCATTACTACTATTATTAATATACGAGCCCCAGGAATAGAATGGGACCTTGTGCCTTTATTCGTTTGATCAGTAATTATTACAGCAGTTCTCCTACTACTCTCACTTCCTGTTCTTGCAGGAGCAATTACTATACTTCTAACAGATCGTAATCTAAATACCTCTTTCTTTGATCCTGC———————–
amino acid sequence
TLYLIMGVWSAMVGTAFSVLIRLELGQPGSLIGNDQIYNVLVTSHAFIMIFFMVMPIMIGGFGNWLVPMMIGAPDMAFPRMNNMSFWLLPPALTLLLMGAAVESGAGTGWTVYPPLASSVAHSGASVDLTIFSLHLAGISSILGAINFITTIINMRAPGMEWDLVPLFVWSVIITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPX——–
Learn more about it’s BIN (Barcode Index Number): BOLD:AAN9178
Leave a Reply