#Biodiversity150 number 18 of 150 Forked Fungus Beetle

18/150: A fungus beetle known for using its head

Animalia: Arthropoda: Insecta: Coleoptera: Tenebrionidae: Bolitotherus: Bolitotherus cornutus (Panzer, 1794)

Male Bolitotherus cornutus, commonly known as the Forked Fungus beetle, have fork-like horns in which they use to compete for mates. Those with bigger horns have better success at prying rivals off of their prized females. After copulation, the females will lay their eggs in the fungi where they will later pupate and emerge as adults. These remarking lumpy beetles are most active at night and can almost always be found living on hard shelf fungi.  Interestingly, they can live more than two years and have been known to play dead when disturbed. #Canada150 #Biodiversity150

Two male forked fungus beetles competing for a female. Photo Credit: Benowitz, K. M.; Brodie, E. D.; Formica, V. A. (2012). Proulx, Stephen R. ed. “Morphological Correlates of a Combat Performance Trait in the Forked Fungus Beetle, Bolitotherus cornutus”. PLoS ONE 7 (8): e42738. doi:10.1371/journal.pone.0042738.
Egg case of the forked fungus beetle on shelf fungi. Photo Credit: Kathie Hodge goo.gl/e4F7Gp

Here’s the barcode sequence information for this species:

Process ID:  TTCFW844-08

nucleotide sequence

AACCCTATATTTCATTTTTGGCGCTTGAGCCGGAATAGTAGGAACATCTCTTAGACTTTTAATTCGTACTGAATTAGGAAACCCAGGCTCACTAATTGGGGATGACCAAATTTATAACGTAATTGTAACTGCTCACGCATTCATTATAATTTTCTTCATAGTAATACCAATTATAATTGGTGGATTTGGAAATTGACTAGTACCTCTTATACTAGGAGCCCCAGATATAGCATTTCCTCGAATAAACAATATAAGATTCTGATTACTACCCCCATCTCTTAGACTTTTAATTATAAGAAGTGTAGTAGAAAATGGAGCAGGAACAGGATGAACAGTATACCCACCTCTTTCTTCTAATATTGCCCACAGAGGCCCATCAGTTGATTTAGCAATTTTCAGTTTACATCTAGCAGGAATTTCTTCAATTTTGGGAGCAGTAAATTTTATTACTACAGTAATTAATATACGACCTAATGGAATAACCCTAGACCGAATACCCCTATTCGTCTGGTCAGTAGTAATTACAGCAGTACTTCTTTTACTTTCTCTACCTGTACTTGCAGGAGCAATTACTATACTATTAACAGATCGAAACATCAATACTTCATTCTTTGACCCAGCAGGTGGAGGAGACCCAATTTTATACCAACATTTATTT

amino acid sequence

TLYFIFGAWAGMVGTSLSLLIRTELGNPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLSLLIMSSVVENGAGTGWTVYPPLSSNIAHSGPSVDLAIFSLHLAGISSILGAVNFITTVINMRPNGMTLDRMPLFVWSVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Forked Fungus Beetle

Learn more about it’s BIN (Barcode Index Number): BOLD:AAF0405

Title Image: Specimen 08MZPP-006 – Point Pelee National Park – 10-Jul-2008
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics