18/150: A fungus beetle known for using its head
Animalia: Arthropoda: Insecta: Coleoptera: Tenebrionidae: Bolitotherus: Bolitotherus cornutus (Panzer, 1794)
Male Bolitotherus cornutus, commonly known as the Forked Fungus beetle, have fork-like horns in which they use to compete for mates. Those with bigger horns have better success at prying rivals off of their prized females. After copulation, the females will lay their eggs in the fungi where they will later pupate and emerge as adults. These remarking lumpy beetles are most active at night and can almost always be found living on hard shelf fungi. Interestingly, they can live more than two years and have been known to play dead when disturbed. #Canada150 #Biodiversity150


Here’s the barcode sequence information for this species:
Process ID: TTCFW844-08
nucleotide sequence
AACCCTATATTTCATTTTTGGCGCTTGAGCCGGAATAGTAGGAACATCTCTTAGACTTTTAATTCGTACTGAATTAGGAAACCCAGGCTCACTAATTGGGGATGACCAAATTTATAACGTAATTGTAACTGCTCACGCATTCATTATAATTTTCTTCATAGTAATACCAATTATAATTGGTGGATTTGGAAATTGACTAGTACCTCTTATACTAGGAGCCCCAGATATAGCATTTCCTCGAATAAACAATATAAGATTCTGATTACTACCCCCATCTCTTAGACTTTTAATTATAAGAAGTGTAGTAGAAAATGGAGCAGGAACAGGATGAACAGTATACCCACCTCTTTCTTCTAATATTGCCCACAGAGGCCCATCAGTTGATTTAGCAATTTTCAGTTTACATCTAGCAGGAATTTCTTCAATTTTGGGAGCAGTAAATTTTATTACTACAGTAATTAATATACGACCTAATGGAATAACCCTAGACCGAATACCCCTATTCGTCTGGTCAGTAGTAATTACAGCAGTACTTCTTTTACTTTCTCTACCTGTACTTGCAGGAGCAATTACTATACTATTAACAGATCGAAACATCAATACTTCATTCTTTGACCCAGCAGGTGGAGGAGACCCAATTTTATACCAACATTTATTT
amino acid sequence
TLYFIFGAWAGMVGTSLSLLIRTELGNPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLSLLIMSSVVENGAGTGWTVYPPLSSNIAHSGPSVDLAIFSLHLAGISSILGAVNFITTVINMRPNGMTLDRMPLFVWSVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF
Learn more about it’s BIN (Barcode Index Number): BOLD:AAF0405
These beetles carry some really cool-looking mites, of several different kinds, too!