23/150: And you thought only vertebrates breathe with lungs? Meet the Arctic Pond Snail

Animalia: Mollusca: Gastropoda: Hygrophila: Lymnaeidae: Stagnicola: Stagnicola arctica (Lea, 1864)

The Arctic Pond Snail (Stagnicola arctica) is a freshwater gastropod belonging to the family Lymnaeidae. This species occurs across northern Canada from Labrador to the Yukon Territory and are typically found in lakes, ponds, rivers, streams, ditches and muskeg pools. Lymnaeidae are of major medical importance as they act as vectors of parasites, such as trematodes and helminths that can affect both livestock and humans. Like other snails, these pond snails take up a portion of their oxygen through cutaneous respiration (skin breathing) but can also breathe using lungs; they have to come to the surface to breathe from time to time. These water pulmonate snails can be identified from their terrestrial pulmonate snail cousins by having two, instead of four, tentacles. There is currently only one specimen of this species that has been barcoded on BOLD. #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID:  PPCHU085-10

nucleotide sequence

–AACTTTGTACATGATTTTTGGTGTTTGATGTGGCTTAGTTGGCACAGGATTATCGTTTTTAATTCGGCTGGAGTTAGGTACGTCAATAGTA—————TTTACTGACGAGCACTTTTATAATGTTATTGTGACTGCACATGCATTTGTAATAATTTTTTTTATGGTTATACCTATAATAATTGGTGGCTTTGGCAATTGGATAGTTCCCTTACTTATTGGCGCTCCTGATATAAGCTTTCCACGAATAAATAATATGAGATTTTGATTACTCCCTCCTTCATTTGTTCTCCTTCTATGCTCAAGAATAGTAGAAGGCGGAGCAGGTACTGGATGAACTGTTTATCCTCCTCTAAGTGGACCTATGGCTCATGGCGGTGCTTCAGTTGATTTAGCTATTTTTTCCTTACATTTAGCAGGACTATCAAGAATTTTAGGGGCTATTAATTTTATTACTACAATTTTTAACATACGATCCCCAGGTATTACGCTGGAACGAATAAGTTTATTTGTTTGATCAGTTTTAGTGACAGCATTCTTACTTCTACTATCATTGCCCGTACTTGCCGGAGCAATTACCATACTATTAACGGACCGTAACTTTAATACCTCTTTTTTTGACCCTGCTGGTGGTGGTGACCCGATCTTATATCAACATTTATTT

amino acid sequence

TLYMIFGVWCGLVGTGLSFLIRLELGTSMV—–FTDEHFYNVIVTAHAFVMIFFMVMPMMIGGFGNWMVPLLIGAPDMSFPRMNNMSFWLLPPSFVLLLCSSMVEGGAGTGWTVYPPLSGPMAHGGASVDLAIFSLHLAGLSSILGAINFITTIFNMRSPGITLERMSLFVWSVLVTAFLLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILYQHLF

Learn more about it’s BIN (Barcode Index Number):  BOLD:AAG9389

Title Image: Specimen PPM170 – Churchill Manitoba Canada – 24-Jul-2009
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics