Animalia: Arthropoda: Insecta: Notoptera: Grylloblattidae: Grylloblatta campodeiformis Walker, 1914

Grylloblatta campodeiformis, also known as the Northern Rock Crawler, is an omnivorous species of insect in the family Grylloblattidae. Like the other species in the genus Grylloblatta, it is endemic to North America. Its classification was so problematic that it was placed in its own family upon its discovery in 1914 and was moved across different orders through the years. These queer creatures have interested entomologists for the past century as they are wingless, active at night and with an unusual preference for cold temperatures! This is why they are usually found in mountains above the tree line in area of higher moisture like the edge of a glacial bog in moss or in damp areas deep under rocks. Little is known of their ecology and lifestyle, but we can suspect that their habitat will soon be under threat of climate change, slowly shifting their distribution to higher altitude until there’s nowhere else to go… #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID:  SSJAA1402-13

nucleotide sequence

AACCTTATACTTCTTATTTGGTGCATGATCAGGAATAGTGGGGACTTCTCTAAGCATATTAATTCGTGCAGAATTAGGTCAACCAGGGGCATTAATTGGTGATGATCAAATTTACAACGTTATTGTTACAGCCCATGCATTTGTAATGATTTTTTTTATAGTTATACCTATTATAATTGGGGGATTTGGAAATTGACTAGTACCACTAATACTAGGAGCACCTGATATAGCCTTCCCACGAATAAATAATATAAGCTTCTGATTACTTCCCCCTTCACTTACCCTGCTACTAACCAGCAGAATAGTAGAAAGAGGAGCAGGAACAGGATGAACAGTTTATCCCCCATTATCTGCTGGAATTGCCCATGCTGGTGCTTCAGTAGATATGGCAATCTTCTCACTACATCTTGCTGGTGCTTCATCAATTTTAGGGGCTGTGAACTTTATCTCCACAGTAATTAATATACGAAGCACAGGAATTACCTTAGAACGAATACCTTTATTTGTATGATCTGTAATAATTACAGCTGTTTTATTACTTCTATCCCTACCTGTTTTGGCTGGTGCAATCACTATACTTTTAACCGATCGTAATCTAAATACATCATTCTTCGATCCGGCAGGAGGAGGAGATCCTATTTTATACCAACACTTATTT

amino acid sequence

TLYFLFGAWSGMVGTSLSMLIRAELGQPGALIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLTSSMVESGAGTGWTVYPPLSAGIAHAGASVDMAIFSLHLAGASSILGAVNFISTVINMRSTGITLERMPLFVWSVMITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Learn more about it’s BIN (Barcode Index Number): BOLD:ACG5954