37/150: The real-life Cyclops

animalia: Arthropoda: Maxillopoda: Cyclopoida: Cyclopidae: Cyclops

Though the name might seem fitting for a monster, Cyclops is a small copepod that happens to share the same body characteristic of a single large eye on its head region with the mythological giant. Cyclops is found widely in freshwater regions and prefers the slow-moving and stagnant bodies of water. These omnivores feed on plants, animals and even carrion. Despite lacking in the size department, the cyclops copepod can still be quite threatening. Diseases such as the guinea-worm diseases and fish tapeworm infections have designated the cyclops to be their intermediary hosts, which have given rise to programs and projects focused on the elimination of these animals near human environments.  #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID:  BBCRU213-12

nucleotide sequence

AACATTATATTTAATTGCTGGAGTCTGAGCAGGAATAATTGGAACTGGGTTAAGAGTAATTATCCGTCTAGAGCTAGGTCAGCCTGGTTCTTTAATGGGGGATGACCAAATTTACAATGTAGTAGTGACAGCTCACGCTTTTGTAATAATTTTTTTTATAGTCATACCTATTTTAATTGGTGGATTTGGAAATTGACTAGTTCCTTTGATACTAGGCTCTCCTGATATAGCATTTCCTCGAATAAATAATATAAGGTTTTGATTTTTAATCCCAGCTCTGTTTATACTCTTAACAAGTTCTTTAGTAGAAAGAGGGGCAGGAACAGGATGAACCGTATACCCTCCTTTAAGAAGTAATTTATCTCATTCGGGATCTTCAGTAGATTACGCTATTTTTTCTTTACATTTAGCTGGGGTATCTTCTATTTTAGGAGCTGTAAATTTTATTAGGACTGTGGGTAATATGCGGACTCTAGGAATATTTTTGGATCGAACTCCTTTATTTGCTTGATCTGTTTTAATTACTGCTATTTTATTACTACTATCTCTACCTGTATTAGCTGGGGCTATTACCATGTTATTAACTGACCGAAATTTAAATACTTCTTTCTATGACCCAAGAGGGGGAGGAGATCCTA——————–

amino acid sequence

TLYLIAGVWAGMIGTGLSVIIRLELGQPGSLMGDDQIYNVVVTAHAFVMIFFMVMPILIGGFGNWLVPLMLGSPDMAFPRMNNMSFWFLIPALFMLLTSSLVESGAGTGWTVYPPLSSNLSHSGSSVDYAIFSLHLAGVSSILGAVNFISTVGNMRTLGMFLDRTPLFAWSVLITAILLLLSLPVLAGAITMLLTDRNLNTSFYDPSGGGDPX——

Learn more about it’s BIN (Barcode Index Number): BOLD:AAG9230

Title Image: Specimen BIOUG02838-C03 – Point Pelee National Park – 22-Jun-2010 – Dip Net
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics