39/150: Are they centipedes or….??

animalia: Arthropoda: Symphyla: Symphyla order incertae sedis: Scolopendrellidae

Also known as symphylans or garden centipedes, pseudocentipedes are only distant relatives of true centipedes! They are actually more closely related to pauropods and millipedes of the same subphylum Myriapoda. They are often found in forests and soil environments 50 cm down the surface. These little critters lack pigment in their body and do not possess eyes. Don’t you worry though; these creatures can still find abundant food sources in the form of decaying vegetation, animals and soil microorganisms. Unfortunately, their menu also includes the seeds and roots of numerous crops! Yes, pseudocentipedes are considered to be nasty pests and have been known to cause crop failures in the agricultural industry. But hey, some species are found up high in caves and trees, so maybe not all are that bad!  #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID:  TTSOW558-11

nucleotide sequence

AACCATATATTTTATTTTAGGAGCATGATCTGCAATAGTAGGAACAGCCATAAGTATAATTATCCGAACAGAACTTAGTACTACTTCTAACTTAATTGGAGATGACCAAATTTACAATGTCATAGTAACAGCTCACGCATTTGTAATAATTTTTTTCATAGTAATACCTGTAATAATAGGAGGATTCGGCAACTTCCTAGTACCAATAATAATTGGAGCCCCAGATATAGCATTTCCACGAATAAACAATATAAGATTCTGGTTACTCCCTCCATCCTTAATAATATTGACAACCTCCGCCGCAGTTGAATCTGGAGCAGGTACAGGATGAACTGTATACCCTCCCCTTGCCTCAAACATTGCCCATGCTGGATCCTCAGTAGATTTTGCAATCTTCTCTCTTCATCTAGCTGGAGCTTCATCAATTATAGGTTCAGCTAATTTTATTACAACTATTATAAACATACGATCAAAAAATATAACTATAGACAAAACACCTCTATTTGTATGATCAGTTCTACTAACAGCTATCCTTCTTCTACTATCCCTCCCAGTCCTAGCAGGAGCCATTACAATACTATTAACAGATCGAAATTTTAATACCTCATTCTTTGACCCGTCAGGAGGAGGAGACCCAATCCTCTATCAACATCTATTC

amino acid sequence

TMYFILGAWSAMVGTAMSMIIRTELSTTSNLIGDDQIYNVMVTAHAFVMIFFMVMPVMMGGFGNFLVPMMIGAPDMAFPRMNNMSFWLLPPSLMMLTTSAAVESGAGTGWTVYPPLASNIAHAGSSVDFAIFSLHLAGASSIMGSANFITTIMNMRSKNMTMDKTPLFVWSVLLTAILLLLSLPVLAGAITMLLTDRNFNTSFFDPSGGGDPILYQHLF

Learn more about it’s BIN (Barcode Index Number): BOLD:ACZ6174

Title Image: Specimen BIOUG00863-G08 – Pacific Rim National Park – 8-Jul-2010 – Berlese Funnel
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics