56/150: Are Moose mothers baby thieves?
animalia: Chordata: Mammalia: Artiodactyla: Cervidae: Capreolinae: Alces: Alces americanus (Linnaeus, 1758)
The second week of May begins the start of moose baby season! Baby moose clock in at approximately 30 pounds and can outrun a person within the first five days. Moose calves and their mothers bond quickly and calves are observed calling and attempting to rouse their mothers into playing (usually without success). Bulls are usually kicked out of the nest the following year, but have been recorded staying with the mother for multiple years if she is unable to get pregnant. Adult females have been observed fostering orphaned calves both in both captivity and in the wild. Things can take a turn for the sinister when females can’t get pregnant, as they may “steal” another mother’s calf and raise it as their own. In Newfoundland, the 150,000 moose recorded are descendants from just four moose that were introduced in the 1900’s. There are 18 Moose with barcodes on BOLD. #Canada150 #Biodiversity150




Here’s the barcode sequence information for this species:
Process ID: ABMWC046-06
nucleotide sequence
NNNNNNNNNTTATTATTTGGTGCTTGAGCAGGCATAGTAGGAACGGCCCTAAGCTTATTAATCCGTGCTGAATTAGGCCAACCTGGAACCCTGCTCGGGGATGATCAAATCTATAATGTAATCGTAACTGCACACGCATTCGTAATAATTTTCTTTATAGTAATACCAATCATAATTGGAGGTTTTGGTAACTGACTTGTTCCCTTGATGATTGGTGCCCCTGATATAGCATTCCCTCGAATAAACAATATGAGTTTCTGACTCCTACCTCCCTCCTTTTTACTGCTTCTAGCATCATCTATAGTTGAAGCCGGAGCAGGCACAGGCTGAACTGTTTATCCCCCTTTAGCTGGAAATCTAGCCCACGCAGGAGCTTCAGTAGACCTAACCATTTTTTCCTTACACTTAGCAGGTGTCTCTTCAATTCTAGGGGCTATTAATTTTATTACAACAATTATTAATATAAAACCCCCTGCTATATCACAATATCAAACCCCTCTATTTGTATGATCAGTACTAATTACTGCTGTACTATTACTTCTTTCACTCCCTGTACTAGCAGCCGGAATTACAATATTATTAACAGACCGAAACTTAAATACAACTTTCTTTGACCCGGCAGGAGGCGGAGATCCTATTCTATATCAACACTTANNN
amino acid sequence
LLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL
Learn more about it’s BIN (Barcode Index Number): BOLD:AAB7972