57/150: Providing A Good Start: The unique parental care of Wolf Spiders

Animalia: Arthropoda: Arachnida: Araneae: Lycosidae: Trochosa: Trochosa ruricola (De Geer, 1778)

The Rustic Wolf Spider belongs to the family Lycosidae, and is known for its keen eyesight and skilled hunting. They occur in a wide range of habitats, including grasslands, woodlands, and scrubs across the globe. While many spiders lay their eggs and leave them be, wolf spiders will go the extra mile to protect their young. The mother encases her eggs in a silk globe, which she then hangs from her spinnerets, allowing her to keep a close eye on them. To ensure the globe doesn’t get damaged, the mother raises her abdomen to keep it off the ground. Despite their need to hold such an odd position, expecting females are still very impressive hunters! After the eggs hatch, the young spiders pack themselves onto their mother’s abdomen, where they continue to enjoy her protection for a while longer. There are 164 Rustic Wolf Spiders with barcodes on BOLD. #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID:  PPELE264-11

nucleotide sequence

TACTTTATATTTAATATTTGGTGTATGATCTGCTATAGTGGGGACTGCTATAAGAGTGTTAATTCGTTTAGAATTAGGAAATTCTGGAAGTTTATTAGGAGATGATCATTTATATAATGTTATAGTTACTGCTCATGCTTTTGTGATGATTTTTTTTATAGTAATGCCAATTCTTATTGGAGGTTTTGGTAATTGATTAATTCCTTTAATGTTAGGTGCTCCTGATATATCATTTCCTCGAATGAATAATCTTTCTTTTTGGTTATTGCCCCCTTCTTTATTTTTATTAACTATGTCTTCTATAGTGGAAATAGGGGTAGGAGCTGGTTGAACAGTTTATCCTCCTTTAGCATCTAGAATAGGTCATATAGGGAGTTCTATAGATTTTGCTATTTTTTCTCTTCATTTAGCTGGTGCTTCTTCTATTATAGGGGCAGTAAATTTTATTTCTACTATTATTAATATACGAATATTAGGTATATCTATAGATAAGGTACCTTTATTTGTTTGGTCAGTTTTGATTACGGCTGTTTTATTATTATTATCTTTACCTGTTTTAGCAGGTGCTATTACTATGTTATTAACTGATCGAAATTTTAATACTTCTTTTTTTGACCCTGCAGGGGGAGGAGATCCTATTTTATTTCAACATTTGTTT

amino acid sequence

TLYLMFGVWSAMVGTAMSVLIRLELGNSGSLLGDDHLYNVMVTAHAFVMIFFMVMPILIGGFGNWLIPLMLGAPDMSFPRMNNLSFWLLPPSLFLLTMSSMVEMGVGAGWTVYPPLASSMGHMGSSMDFAIFSLHLAGASSIMGAVNFISTIINMRMLGMSMDKVPLFVWSVLITAVLLLLSLPVLAGAITMLLTDRNFNTSFFDPAGGGDPILFQHLF

Learn more about it’s BIN (Barcode Index Number): BOLD:AAB0726