63/150: The Ultimate Diving Champion
animalia: Chordata: Aves: Anseriformes: Anatidae: Clangula: Clangula hyemalis (Linnaeus, 1758)
Now this species is set for the Olympics! The Long-tailed Duck (Clangula hyemalis) – formerly known as Oldsquaw – sets the record for one of the deepest diving ducks (over 60 metres)! Whereas Olympic athletes perform impressive feats like these for medals, the Long-tailed Duck must dive to survive. It uses its diving technique to forage for food deep below the surface, such as insects and crustaceans. The Long-tailed Duck may spend up to FOUR times as much time under the water than on top of the water when foraging. You can find the Long-tailed Duck on the coasts of North America, anywhere from lakes to oceans! There are currently 23 Long-tailed Ducks barcoded on BOLD. #Canada150 #Biodiversity150

goo.gl/kx84Kj


Here’s the barcode sequence information for this species:
Process ID: BROMB294-06
nucleotide sequence
GTGACCTTCATCAATCGATGATTATTCTCTACTAACCACAAAGATATCGGCACCTTATACCTTATCTTCGGAGCATGAGCCGGAATAATCGGCACCGCACTCAGCCTGCTAATCCGCGCAGAACTGGGCCAACCAGGAACCCTCCTGGGTGATGACCAAATTTACAATGTAATCGTCACCGCCCACGCATTTGTAATAATCTTCTTCATAGTAATGCCTATCATAATCGGAGGATTTGGCAACTGATTAGTCCCCCTAATAATCGGCGCCCCTGACATGGCATTCCCACGAATAAACAACATGAGCTTTTGACTCCTCCCACCCTCCTTCCTCTTACTGCTCGCCTCATCTACCGTAGAAGCTGGCGCTGGCACAGGCTGAACCGTATATCCGCCCCTAGCAGGCAACCTAGCCCACGCCGGAGCCTCAGTAGACCTAGCCATCTTCTCACTCCATCTAGCCGGTGTCTCCTCCATCCTCGGGGCCATCAACTTCATCACCACAGCCATTAACATAAAACCTCCCGCACTCTCACAATACCAAACCCCCCTTTTCGTCTGATCCGTCCTAATCACCGCCATCCTACTCCTCCTATCACTCCCCGTCCTCGCTGCCGGTATCACAATACTACTTACCGACCGAAATCTAAACACCACATTCTTTGACCCCGCCGGAGGGGGAGACCCAATCCTGTACCAACACCTGTTCTGATTCTTCGGCCACCCAGAAGTCTATATCCTAATCC———————————————————————————————————————————————-
amino acid sequence
VTFINRWLFSTNHKDIGTLYLIFGAWAGMIGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLAGNLAHAGASVDLAIFSLHLAGVSSILGAINFITTAINMKPPALSQYQTPLFVWSVLITAILLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGHPEVYILIX———————————————–
Learn more about it’s BIN (Barcode Index Number): BOLD:AAB6263