#Biodiversity150 number 64 of 150 Feather Star

64/150: Birds of the Sea

Animalia: Echinodermata: Crinoidea: Comatulida: Antedonidae: Heliometrinae: Florometra: Florometra serratissima (AH Clark, 1907)

While you wouldn’t think birds would be able to exist in the ocean, the common feather star Florometra serratissima could very well be considered the bird of the sea! They are able to move around either by grasping terrain with their claw-like cirri or by swimming through the water with their feather-like arms. The cirri are root-like filaments on the oral surface of the organism, and the arms on the aboral surface possess pinnules that give the appendages its feather-like appearance. These rusty-coloured echinoderms are suspension feeders that dwell in the deep ocean, so it’s unlikely to come across one. Common feather stars are relatives of the typical sea stars we know and love, and similarly have the ability to regenerate damaged body parts! #Canada150 #Biodiversity150

Common feather star clung to terrain with its cirri. Photo Credit: Myles Clough goo.gl/ixiFgM
Group of common feather stars. Photo Credit: NOAA Photo Library goo.gl/NxR49g

Here’s the barcode sequence information for this species:

Process ID:  CHEC034-11

nucleotide sequence

TACTTTGTATTTTCTTTTTGGTGCTTGGGCTGGTATGGTTGGTACTGCTTTAAGAATTATAATTCGTACAGAGTTATCTCAACCTGGTTCTTTTTTAGGAGATGATCAAATTTATAAAGTAATTGTAACTTCTCATGCTTTAATAATGATTTTTTTTATGGTAATGCCAATAATGATAGGTGGTTTTGGTAATTGATTAATTCCTTTAATGATAGGAGCTCCTGATTTGGCTTTTCCTCGTGTAAAAAAAATGAGTTTTTGGTTACTTCCTCCTTCTTTTCTTCTTTTATTAGCTTCTGCTGGTGTAGAAAGGGGTGCTGGTACAGGTTGAACTATTTATCCTCCTTTATCAAGTGGTTTAGCACATTCTGGAGGTTCTGTTGATCTTGCTATTTTTTCTTTACATATTGCTGGTGCTTCTTCTATTGTTGCTTCTATAAATTTTATTACAACTGTAATAAAAATGCGCTCTCCGGGGGTTACTTTTGATCGTTTGCCTTTATTTGTTTGATCTGCTTTTATTACGGCTTTTCTTCTTTTATTATCTCTTCCAGTTTTAGCTGGTGCTATAACTATGCTTCTTACTGATCGTAATATTAATACTACTTTTTTTGATCCGGCTGGTGGTGGTGATCCTATTTTATTTCAGCATTTATTT

amino acid sequence

TLYFLFGAWAGMVGTALSIMIRTELSQPGSFLGDDQIYKVIVTSHALMMIFFMVMPMMMGGFGNWLIPLMMGAPDLAFPRVKKMSFWLLPPSFLLLLASAGVESGAGTGWTIYPPLSSGLAHSGGSVDLAIFSLHIAGASSIVASMNFITTVMKMRSPGVTFDRLPLFVWSAFITAFLLLLSLPVLAGAMTMLLTDRNINTTFFDPAGGGDPILFQHLF

Visual representation of DNA barcode sequence for Feather Star

Learn more about it’s BIN (Barcode Index Number): BOLD:AAC3353

Title Image: Specimen 10CHEC-034 – Baffin Bay, Canada – 16-September-2010 – Agassiz Trawl
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics

Comments

Leave a Reply

Your email address will not be published. Required fields are marked *