Animalia: Annelida: Clitellata: Arhynchobdellida: Erpobdellidae: Erpobdella: Erpobdella obscura (Verrill, 1872)
This past week Canadian Blood Services has been promoting awareness of blood donation with Blood Donor Week. We thought we’d share some info about leeches. On first mention of leeches, many people probably think of Hirudo medicinalis, the medicinal leech. But this is only one of almost 700 different species of leeches. Most species do not actually feed on blood! Leeches mainly live in freshwater environments, but can be found in terrestrial or marine environments. The Ribbon leech, Erpobdella obscura, is found in freshwater throughout North America. It’s a large leech, and preys on small invertebrates, and other debris found in a pond or lake. If you fish for walleye, you have likely used this species as bait! They are popular as bait: their waving movement draws the attention of fish. An interesting tidbit about this leech is that its semelparous- it only reproduces one time before death, as opposed to other organisms that reproduce repeatedly throughout their lifetime. #Leech #Canada150 #Biodiversity150
Here’s the barcode sequence information for this species:
Process ID: JCLCH005-10
nucleotide sequence
AACCTTGTACTTTATCCTAGGTGCATGGTCAGCAATAGCAGGAACAGGCATAAGAGTACTAATTCGGATTGAATTAGCTCAACCTGGTACCTTTTTAGGAAACGATCAAATTTATAATACAATTGTCACAGCTCATGGGTTAGTAATAATTTTCTTTATAGTAATGCCTATTTTAATTGGAGGGTTTGGAAATTGGTTAATCCCTTTAATAATCGGGGCACCAGATATAGCATTCCCACGACTAAATAATTTAAGATTCTGATTACTACCTCCGTCTATAATTATATTAGTATTTTCCGCTTTTGTAGAAAATGGTGTAGGTACTGGATGAACAGTATATCCTCCATTAGCCTATAATATTGCACATTCTGGCCCATCTGTAGACATAGCTATTTTCTCATTACATTTAGCTGGGGCTTCATCTATTTTAGGTTCCTTAAACTTTATTTCTACTGTAGCTAATATACGATGAAAAGGAATAACATTAGACCGAGTCCCACTATTTATTTGATCTGTAGTAATTACAACAGTTCTTTTATTACTATCATTACCAGTATTAGCTGCAGCTATTACAATACTATTAACAGACCGAAATTTAAATACATCCTTCTTTGATCCAGCTGGTGGAGGAGACCCTATCCTATTTCAACACTTATTT
amino acid sequence
TLYFILGAWSAMAGTGMSVLIRIELAQPGTFLGNDQIYNTIVTAHGLVMIFFMVMPILIGGFGNWLIPLMIGAPDMAFPRLNNLSFWLLPPSMIMLVFSAFVENGVGTGWTVYPPLAYNIAHSGPSVDMAIFSLHLAGASSILGSLNFISTVANMRWKGMTLDRVPLFIWSVVITTVLLLLSLPVLAAAITMLLTDRNLNTSFFDPAGGGDPILFQHLF
Learn more about it’s BIN (Barcode Index Number): BOLD:AAB4504
Leave a Reply