80/150: No stone unturned!

Animalia: Arthropoda: Hexapoda: Insecta: Plecoptera: Perloidea: Perlidae: Acroneuria: Acroneuria abnormis (Newman, 1838)

Stoneflies are insects that can be found worldwide (other than Antarctica) with 3,500 species known globally and many more being discovered! Stoneflies are known for being extremely vulnerable to pollution thus the presence of these insects are a great sign of clean water habitats. It is during the aquatic nymphal stage that they can be found in clean lakes, rivers and streams because of the abundance of oxygen. Some stonefly species are herbivorous, feeding upon fallen leaves and algae, while other species are carnivorous feeding on other small arthropods. Adult females are able to lay around 1000 eggs which they either deposit in the water or attach to twigs and rocks so that they aren’t swept away. Once the eggs hatch they can stay a nymph for a couple of years while the adults usually only live for a few weeks, and some adults may not even have mouthparts for feeding! #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID:  SWFRN728-16

nucleotide sequence

ACTTTATACTTCATCTTTGGTGCATGGTCAGGCATAGTAGGTACTGCCCTAAGCCTTCTCATTCGTGCTGAACTTGGTCAACCTGGCTCATTAATTGGGGACGATCAAATCTATAACGTCATTGTAACAGCCCACGCTTTTGTTATAATTTTCTTCATAGTTATACCAATTATGATTGGAGGGTTTGGGAATTGATTAGTACCTTTAATACTTGGGGCACCAGATATAGCTTTCCCTCGAATAAACAACATAAGTTTTTGGTTATTACCCCCATCTTTAACACTACTACTGGCCAGTAGCTTAGTCGAAAACGGAGCGGGCACCGGATGAACGGTCTACCCCCCACTTTCAGCAGGAATCGCTCATGCAGGTGCCTCCGTTGACATGGCTATCTTCTCCTTGCACTTAGCAGGGGTATCCTCGATTCTAGGAGCCGTAAACTTTATCACCACAGTGATCAATATACGATCAGCAGGAATAACCCTTGATCGTATACCTTTATTTGTGTGAGCAGTAGCTATCACAGCGTTGTTACTCCTCCTTTCCCTACCAGTTCTTGCCGGGGCAATCACAATATTATTAACAGACCGAAAT——————————————

amino acid sequence

TLYFIFGAWSGMVGTALSLLIRAELGQPGSLIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLASSLVENGAGTGWTVYPPLSAGIAHAGASVDMAIFSLHLAGVSSILGAVNFITTVINMRSAGMTLDRMPLFVWAVAITALLLLLSLPVLAGAITMLLTDRN————–

Learn more about it’s BIN (Barcode Index Number): BOLD:AAB2220

Title Image: Specimen 09CBSTO-082 – New Brunswick, Canada – 28-Jul-2009
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics