#Biodiversity150 number 82 of 150 Praying Mantis

82/150: A ravenous bride; the female Praying Mantis is one of nature’s most ruthless predators!

Animalia: Arthropoda: Insecta: Mantodea: Mantidae: Mantinae: Mantis: Mantis religiosa (Linnaeus, 1758)

The Praying Mantis (Mantis religiosa) is an insect species of the Order Mantodea which was accidentally introduced to Canada in 1899 from Europe. A common, and intimidating, fact about the Praying Mantis proves how insatiable the female is when pregnant, leading her to partake in sexual cannibalism. This is thought to increase the survival of potential offspring by giving the female much needed nutrition for growing her eggs. Mantids lay their eggs in large sacs called ootheca which can contain up to 300 eggs per sac, so those added nutrients don’t go to waste! Despite their notoriety as indiscriminate predators, Mantids are harmless to humans. So, don’t be scared to say hello if you bump into one in the tall grass this summer! #Canada150 #Biodiversity150

Specimen MANT 0004.02 – Puslinch, Ontario, Canada – 22-Sept-2002. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Ootheca (egg case) of Praying Mantis, Mantis religiosa. Photo Credit: Hans Hillewaert goo.gl/x3AYqg

Here’s the barcode sequence information for this species:

Process ID: TTDIW056-09

nucleotide sequence

AACATTATATTTTATCTTTGGTGCTTGAGCTGGAATATTAGGAACATCATTAAGTATTTTAATTCGAACAGAATTAGGTCAACCAGGTTCATTAATTGGAGATGATCAAATCTACAATGTTATTGTTACTGCTCATGCCTTCATTATAATTTTTTTTATAGTTATACCAATCATGATTGGAGGATTTGGTAATTGATTAGTTCCTTTAATACTTGGAGCACCTGATATAGCATTTCCTCGAATAAATAATATAAGATTTTGATTACTTCCTCCTTCAATTTTATTATTACTAATTAGTAGAACAGTTGAAAGAGGAGCTGGAACAGGATGAACTGTTTATCCCCCTTTATCAGCAAGAATTGCCCATGCAGGACCTGCCGTAGATTTAACAATTTTTTCCCTTCACTTAGCAGGTATATCTAGCATTATAGGAGCAGTTAATTTTATTACAACTATAATTAATATAAAACCTATTTATATAAATCAAACTCAAGTTCCACTTTTTGTTTGATCTGTAGGTATTACAGCTCTACTTTTATTATTATCTCTACCAGTTCTTGCAGGAGCAATTACTATACTTTTAACTGATCGAAATCTTAATACATCCTTCTTTGATCCAGCAGGAGGAGGTGATCCAATTTTATATCAACATTTATTT

amino acid sequence

TLYFIFGAWAGMLGTSLSILIRTELGQPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSILLLLISSTVESGAGTGWTVYPPLSASIAHAGPAVDLTIFSLHLAGMSSIMGAVNFITTMINMKPIYMNQTQVPLFVWSVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Praying Mantis

Learn more about it’s BIN (Barcode Index Number): BOLD:AAF4833