#Biodiversity150 number 84 of 150 Tardigrade

84/150: Tardigrades – You Can’t Kill Me!

Animalia: Tardigrada: Eutardigrada: Apochela: Milnesiidae

Tardigrades are known by a variety of names such as water bears, space bears and my personal favorite, moss piglets! These organisms are microscopic in size reaching a full length of 0.5mm when fully grown with eight stubby legs protruding from the body. They are resilient little creatures that live in a multitude of harsh environments from the deep trenches of the ocean to the vastness of space. They mainly feed on various types of moss and algae but have been known to munch on tiny invertebrates as well. These little guys are notorious for being “unkillable”. When under extreme stress they can undergo cryptobiosis where their metabolism slows down to a fraction of the usual (<0.01% of normal!) and then use a damage suppressor protein to protect their DNA from radiation as well as extreme hot and cold temperatures. They can survive 1000 times more radiation, 1200 times standard atmospheric pressure, 10 years of dehydration, environmental toxins and the conditions of space! #Canada150 #Biodiversity150

A view of the ventral side of a tardigrade, . Look at its stubby legs! Photo Credit: Goldstein Lab goo.gl/p14bDJ
Adult tardigrade with the presence of eggs. Photo Credit: Willow Gabriel (Goldstein Lab) goo.gl/inVeN2

Here’s the barcode sequence information for this species:

Process ID: MYMCE448-12

nucleotide sequence

——-TATTTTATTTTTGGTATTTGATGTGCTTTTGTTGGGTCAGCTTTAAGAATGTTAATTCGACTTGAGCTTTCTCAGCCTAATACAATATTAATAAGTGAAGACATTTATAATGCGTTTATTACTAGTCATGCTTTAGTAATAATTTTTTTTTTTGTTATACCGGTTTTAATTGGAGGATTTGGAAATTGATTAGTACCTTTAATAATTAGTTCTCCTGACATAGCTTTTCCTCGTATTAACAATGTAAGATTTTGAATATTGGTAGCTTCTTTTATGCTATTGGTTTATAGAATATTTTGTGGTGAAGGGGTGGGGGCTGGTTGAACTCTTTATCCTCCCCTAACTAATATTTATGGGCATAGAAGAACTGCTGTGGATTATGCTATTTTATCTTTACATGTTGCTGGTGCATCTTCTATTTTTAGTGCTATGAATTTTTTGACAACTATTTTTAATATACATTATTTTGGAGTACGAATAGACAAACTTCCTTTGTTTGTATGGTCTATTTTTATTACAGCTTTATTGTTAGTATTAGCTTTACCTGTTTTAGCTGGGGCTATTACAATG———————————————————————————

amino acid sequence

YFIFGIWCAFVGSALSMLIRLELSQPNTMLMSEDIYNAFITSHALVMIFFFVMPVLIGGFGNWLVPLMISSPDMAFPRINNVSFWMLVASFMLLVYSMFCGEGVGAGWTLYPPLTNIYGHSSTAVDYAILSLHVAGASSIFSAMNFLTTIFNMHYFGVRMDKLPLFVWSIFITALLLVLALPVLAGAITM—————————

Visual representation of DNA barcode sequence for Tardigrade

Learn more about it’s BIN (Barcode Index Number): BOLD:ABV1903


Comments

Leave a Reply

Your email address will not be published. Required fields are marked *