92/150: The Canadian Cicada, true North strong and free

Animalia: Arthropoda: Insecta: Hemiptera: Cicadidae: Okanagana: Okanagana canadensis (Provancher, 1889)

Canadian Cicada is a very fitting name for this species as it is the most northerly found cicada, being seen as far north as the North West Territories. They can be found throughout Canada and the northern United States. Although it has been found in many different habitats, the Canadian cicada prefers conifer wood habitats like pine forests. Males of this species are typically found solitary on trees attempting to attract mates with their call. The trill of the Canadian cicada has a rate of 22 pulses per second with a frequency that peaks at 9 kHz. Males stay put in their trees, and females will approach calling males to mate. In years with large population sizes, Canadian cicadas are sometimes mistaken for periodical cicadas like the 17 year cicada, but small morphological differences such as their narrow forewings and dorsal yellow dots help discern their identification. #Canada150 #Biodiversity150

Have a listen to the Canadian Cicada!

Here’s the barcode sequence information for this species:

Process ID:  CNCHC1808-11

nucleotide sequence

TACCTTATATTTCATTTTTGGAATTTGATCTGGTATAGTGGGTACTGGTTTGAGAATATTAATTCGTATTGAATTAGGAATTCCTGGATCTTTTATTGGAGATGATCAAATTTATAATGTTATTGTTACAGCTCATGCTTTTATTATAATTTTTTTTATAGTTATACCTATTATAATTGGTGGATTTGGAAATTGACTAATTCCATTAATAATTGGTGCTCCGGATATAGCATTTCCTCGCATAAATAATATGAGATTCTGATTATTACCTCCTTCATTAACACTTTTACTTATAGGAGGTATAGTTGATAGAGGTGCCGGTACAGGATGAACTGTTTATCCCCCACTTTCTAGAATTATTGCTCATTCTGGGGCTAGAGTGGATTTAACAATTTTTTCTTTACATCTTGCTGGTGTTTCTTCAATTTTAGGTGCAGTAAATTTTATTAGAACAATTTTTAATATACGTTCTCAAGGTATTTTTCTTGATCGTACTCCATTATTTGTTTGAGCTGTTATAGTAACAGCATTTTTGTTATTACTTTCTTTGCCTGTTCTTGCAGGGGCAATTACAATACTTTTAACTGATCGTAATATAAATACTTCTTTTTTTGATCCAGCTGGAGGGGGAGATCC———————-

amino acid sequence

TLYFIFGIWSGMVGTGLSMLIRIELGIPGSFIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSLTLLLMGGMVDSGAGTGWTVYPPLSSIIAHSGASVDLTIFSLHLAGVSSILGAVNFISTIFNMRSQGIFLDRTPLFVWAVMVTAFLLLLSLPVLAGAITMLLTDRNMNTSFFDPAGGGDX——-

Learn more about it’s BIN (Barcode Index Number): BOLD:ABU7323