95/150: I may be small, but I’m deadly in my tiny world!
Animalia: Chaetognatha: Sagittoidea
Chaetognatha, commonly known as arrow worms are marine invertebrates that range in size from 2 to 120 millimeters. Arrow worms are fierce predators that locate their prey, typically copepods and other zooplankton, by detecting their vibration and then use their sharp hooks and teeth at the front of their bodies to grab and immobilize their prey with neurotoxins. These transparent predators are mostly planktonic (about 20% are benthic) marine invertebrates that are very important to the marine food web as they can be very abundant in some areas, therefore taking up a large portion of the biomass. They are found in all marine waters, from tropical waters to shallow tide pools and the deep sea. Few people know about these fierce invisible predators, but they are quite swift and deadly! #Canada150 #Biodiversity150


Here’s the barcode sequence information for this species:
Process ID: CAISN1281-13
nucleotide sequence
—ACATTGTACCTTATTTTTGGTGCAGTATCAGGTGTTGCTGGTACAGCATTATCTTTATATATCCGAATTACATTAGCACAGCCTAATAGTAGTTTTCTAGAGCATAATCATCAAATGTATAATGTTATTGTAACAGGGCACGCTTTTGTTATGATTTTCTTTATGGTTATGCCTACTTTAATTGGTGGTTTTGGTAACTGGTTTGTACCTCTAATGATTGGTGCTCCAGATATGGCATTTCCACGAATGAACAATATTAGTTTTTGGTTACTACCACCATCATTACTATTGTTAATAGCTTCAATTTTATCAGAAGCTGGTGTGGGTACTGGTTGGACCGTGTATCCTCCTTTATCTAGTGGTACT—TCACATTCAGGAGGTGCTGTTGATTTAGCTATTTTTAGTTTACACTTATCAGGAGCTTCATCAATTTTAGGTGCTATAAACTTTATTTGTACCATTTTTAACATGCGAGTTAAAAGTTTATCG—TTCCATAAATTACCACTATTTGTATGGGCTGTATTAATAACAGCATTTTTACTTTTATTATCATTACCTGTTTTAGCAGGTGCTATTACAATGTTATTAACAGATAGAAATTTCAATACAACATTCTTTGATCCTGCTGGTGGAGGTGACCCAATTTTATACCAACATTTATTT——————————————
amino acid sequence
TLYLIFGAVSGVAGTALSLYIRITLAQPNSSFLEHNHQMYNVIVTGHAFVMIFFMVMPTLIGGFGNWFVPLMIGAPDMAFPRMNNISFWLLPPSLLLLMASILSEAGVGTGWTVYPPLSSGT-SHSGGAVDLAIFSLHLSGASSILGAMNFICTIFNMRVKSLS-FHKLPLFVWAVLMTAFLLLLSLPVLAGAITMLLTDSNFNTTFFDPAGGGDPILYQHLF————–
Learn more about it’s BIN (Barcode Index Number): BOLD:ACM7138