#Biodiversity150 number 95 of 150 Chaetognatha

95/150: I may be small, but I’m deadly in my tiny world!

Animalia: Chaetognatha: Sagittoidea

Chaetognatha, commonly known as arrow worms are marine invertebrates that range in size from 2 to 120 millimeters. Arrow worms are fierce predators that locate their prey, typically copepods and other zooplankton, by detecting their vibration and then use their sharp hooks and teeth at the front of their bodies to grab and immobilize their prey with neurotoxins. These transparent predators are mostly planktonic (about 20% are benthic) marine invertebrates that are very important to the marine food web as they can be very abundant in some areas, therefore taking up a large portion of the biomass. They are found in all marine waters, from tropical waters to shallow tide pools and the deep sea. Few people know about these fierce invisible predators, but they are quite swift and deadly!  #Canada150 #Biodiversity150

Transparent Chaetognatha with internal organs visible. Photo Credit: Zatelmar goo.gl/6Q88yj
Electron microscope image of chaetognath Sagitta. Photo Credit: Zatelmar goo.gl/RwA66D

Here’s the barcode sequence information for this species:

Process ID: CAISN1281-13

nucleotide sequence

—ACATTGTACCTTATTTTTGGTGCAGTATCAGGTGTTGCTGGTACAGCATTATCTTTATATATCCGAATTACATTAGCACAGCCTAATAGTAGTTTTCTAGAGCATAATCATCAAATGTATAATGTTATTGTAACAGGGCACGCTTTTGTTATGATTTTCTTTATGGTTATGCCTACTTTAATTGGTGGTTTTGGTAACTGGTTTGTACCTCTAATGATTGGTGCTCCAGATATGGCATTTCCACGAATGAACAATATTAGTTTTTGGTTACTACCACCATCATTACTATTGTTAATAGCTTCAATTTTATCAGAAGCTGGTGTGGGTACTGGTTGGACCGTGTATCCTCCTTTATCTAGTGGTACT—TCACATTCAGGAGGTGCTGTTGATTTAGCTATTTTTAGTTTACACTTATCAGGAGCTTCATCAATTTTAGGTGCTATAAACTTTATTTGTACCATTTTTAACATGCGAGTTAAAAGTTTATCG—TTCCATAAATTACCACTATTTGTATGGGCTGTATTAATAACAGCATTTTTACTTTTATTATCATTACCTGTTTTAGCAGGTGCTATTACAATGTTATTAACAGATAGAAATTTCAATACAACATTCTTTGATCCTGCTGGTGGAGGTGACCCAATTTTATACCAACATTTATTT——————————————

amino acid sequence

TLYLIFGAVSGVAGTALSLYIRITLAQPNSSFLEHNHQMYNVIVTGHAFVMIFFMVMPTLIGGFGNWFVPLMIGAPDMAFPRMNNISFWLLPPSLLLLMASILSEAGVGTGWTVYPPLSSGT-SHSGGAVDLAIFSLHLSGASSILGAMNFICTIFNMRVKSLS-FHKLPLFVWAVLMTAFLLLLSLPVLAGAITMLLTDSNFNTTFFDPAGGGDPILYQHLF————–

Visual representation of DNA barcode sequence for Chaetognatha

Learn more about it’s BIN (Barcode Index Number): BOLD:ACM7138

Title Image: Specimen BIOUG04842-D10 – Nunavut, Canada – 15-Aug-2012
Photo Credit: Rob Young, Centre for Biodiversity Genomics

Comments

Leave a Reply

Your email address will not be published. Required fields are marked *