#Biodiversity150 number 97 of 150 Myrmica quebecensis

97/150: An Ant Found Only In Canada

Animalia: Arthropoda: Insecta: Lepidoptera: Hymenoptera: Formicidae: Myrmicinae: Myrmica: Myrmica quebecensis (Francoeur 1981)

The ant species Myrmica quebecensis is a species endemic to Canada with an interesting biology. Rather than sustaining their own colonies, these ants are social parasites that rely on the colonies of another ant species to survive. They live within the colony of their host species, Myrmica alaskensis, where they produce hormones to influence their host queen to develop her eggs into workers. These hormones also direct the host ants to raise the sexual, reproductive parasite ants and allows the parasite colony to grow using the resources acquired by the host colony. There are only four ant specimens of this species with barcodes on BOLD! #Canada150 #Biodiversity150

Specimen 10BBCFO-0282 – Elk Island National Park – Alberta – Free Hand. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Head view of Myrmica quebecensis. Photo Credit: April Nobile goo.gl/1vs1T4
Myrmica alaskensis ant, the host species of Myrmica quebecensis. Photo Credit: April Nobile goo.gl/FcfyNt

Here’s the barcode sequence information for this species:

Process ID: BBFOB282-10

nucleotide sequence

AATTTTATATTTTATCTTTGCTATTTGAGCTGGGATAATTGGATCTTCTATAAGTATAATTATTCGTTTAGAATTAGGATCTTGCAATCCCCTAATTAATAATGACCAAATTTATAATACTTTAGTGACTAGTCACGCATTTATTATAATTTTTTTCATAGTTATGCCTTTTATAATTGGAGGATTCGGAAATTTTCTAATTCCTTTAATATTAGGGTCCCCTGACATAGCTTACCCTCGAATAAATAACATAAGGTTTTGACTCCTCCCCCCTTCAATTATATTATTAATATTAAGAAACTTTTTAAGGAATGGAGTAGGAACAGGATGAACTATTTACCCCCCCTTAGCCTCTAATATTTTCCATAGGGGCCCCTCAATTGATATATCTATTTTTTCTCTTCATATAGCCGGAATATCCTCAATTTTAGGAGCAATCAATTTTATTTCTACAATTATTAATATAAACCACAAATCTATTTCTATAGATAAAATCCCTCTAATAGTATGATCAATTTTAATTACCGCTGTTTTACTTCTTCTTTCCCTCCCGGTATTAGCTGGAGCTATTACTATATTATTAACAGATCGAAATTTAAATACTTCTTTTTTTGATCCTTCTGGGGGAGGAGATCCTATTTTATACCAACATTTATTT

amino acid sequence

ILYFIFAIWAGMIGSSMSMIIRLELGSCNPLINNDQIYNTLVTSHAFIMIFFMVMPFMIGGFGNFLIPLMLGSPDMAYPRMNNMSFWLLPPSIMLLMLSNFLSNGVGTGWTIYPPLASNIFHSGPSIDMSIFSLHMAGMSSILGAINFISTIINMNHKSISMDKIPLMVWSILITAVLLLLSLPVLAGAITMLLTDRNLNTSFFDPSGGGDPILYQHLF

Visual representation of DNA barcode sequence for Myrmica quebecensis

Learn more about it’s BIN (Barcode Index Number): BOLD:AAA1845

Leave a Reply

Your email address will not be published.