#Biodiversity150 number 98 of 150 Cockroach

98/150: Cockroaches, the probable survivors of an apocalyptic future

Animalia: Arthropoda: Insecta: Blattodea: Ectobiidae: Parcoblatta: Parcoblatta pennsylvanica (De Geer, 1773)

Cockroaches are one of the most adapted and ancient group of animals still in existence today. They are found on every continent except Antarctica and can survive being decapitated, being submerged in water and high levels of radiation, thanks to their open circulatory system. Cockroaches have been observed surviving 10,000 radon units of radiation, which is equivalent to the Hiroshima atomic bomb. This is attributed to the slow level of cellular division in cockroaches, since radiation specially targets dividing cells.  While cockroaches may excite the ‘eww” factor for many people, cockroaches are one of the most intelligent insect group studied, exhibiting social learning, group decision making, and a surprising ability to self- medicate. When a group of cockroaches being studied were infected with a parasite, the cockroaches migrated to colder habitats to slow down the parasite’s development. So, while you may not be a fan of the cockroaches in your kitchen, one must still appreciate the wonderful adaptability of these little critters. #Canada150 #Biodiversity150

A Pennsylvania wood cockroach, one of many species of cockroaches. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
The infamous Madagascar Hissing Cockroaches, one of the largest species of cockroaches. Photo Credit: Liz West goo.gl/MycHhn
Female cockroach with ootheca, a hard egg sac which protect the eggs. Photo Credit: Toby Hudson goo.gl/o6sAaK

Here’s the barcode sequence information for this species:

Process ID: TTDIW046-09

nucleotide sequence

AACTTTATATTTCATTTTTGGTGCATGATCAGGTATAGTAGGAACATCTTTAAGTATACTAATTCGAGCTGAATTAAATCAACCAGGATCTTTAATTGGAGATGATCAAATCTATAATGTAATTGTAACAGCCCATGCATTTATTATAATTTTTTTCATAGTTATACCAATTTTAATTGGGGGTTTTGGAAATTGATTAGTACCATTAATATTAGGAGCACCAGATATAGCATTTCCACGAATAAATAATATAAGATTCTGATTATTACCACCTTCATTATCCCTTTTGTTAGCCAGTAGTCTAGTAGAAAGTGGTGCTGGCACAGGTTGAACTGTATACCCCCCACTAGCTAGAGGTATTGCTCATGCTGGAGCATCAGTTGATCTTGCTATTTTTTCTCTTCATTTGGCTGGTGTATCCTCTATTCTAGGAGCTGTTAATTTCATTTCAACCACAATCAATATAAAACCAATTAATATAAGACCTGATCGAATTCCTCTCTTTGTTTGAGCAGTAGCTATTACAGCTTTATTATTATTGCTCTCACTACCAGTGTTGGCAGGGGCAATCACAATACTATTAACTGATCGAAACTTAAATACCTCATTTTTTGATCCAGCTGGGGGAGGAGATCCAATTTTATATCAACATTTATTT

amino acid sequence

TLYFIFGAWSGMVGTSLSMLIRAELNQPGSLIGDDQIYNVIVTAHAFIMIFFMVMPILIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLSLLLASSLVESGAGTGWTVYPPLASGIAHAGASVDLAIFSLHLAGVSSILGAVNFISTTINMKPINMSPDRIPLFVWAVAITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Cockroach

Learn more about it’s BIN (Barcode Index Number): BOLD:AAE3407

Leave a Reply

Your email address will not be published. Required fields are marked *