149/150: Not your typical song scales

Animalia: Arthropoda: Insecta: Hemiptera: Sternorrhynncha: Coccoidea: Diaspididae: Quadraspidiotus: Quadraspidiotus perniciosus (Comstock, 1881)

Scale bugs are some pesky critters. Belonging to the order Hemiptera, they have a defining beak like characteristic used to suck out the contents of its prey. The females are typically immobile and have a waxy scale like surface whereas the males have one set of functioning forewings and suppressed hindwings. Continue reading “149/150: Not your typical song scales”

141/150: Oh, Oh, Oh, Sweet Serviceberry of Mine!

Plantae: Magnoliophyta: Magnoliopsida: Rosales: Rosaceae: Amelanchier: Amelanchier alnifolia (Thomas Nuttall)

The Amelanchier alnifolia or commonly known as the Saskatoon serviceberry is found widely across the Americas. Its name is derived from the Cree word “misaskwatomina” meaning “fruit of the tree with many branches”. This hardy plant requires little attention with plenty of sunlight and mulch, similar to your old pet rock that you forgot about. In autumn, the colours of the leaves turn a radiant reddish-purple and yellowish-gold. Additionally, the Saskatoon serviceberry is a food of the past! Travelers and early settlers ate its berries as a sweet alternative to their everyday meals. Humans are not the only ones to value its gifts, some pest species such as aphids and thrips feed on the serviceberry as well. This species is represented with 18 records on BOLD. #Biodiversity150 #Canada150

Specimen ERM457 – Vancouver Island, British Columbia – 6-Jun-2011. Photo Credit: UBC Herbarium
The flower of Saskatoon serviceberry. Photo Credit: Hansen’s Northwest Native Plant Database goo.gl/b3V9Gw

Here’s the barcode sequence information for this species:

Process ID: BBYUK1576-12

nucleotide sequence

AGTGTTGGATTCAAAGCTGGTGTTAAAGATTATAAATTGACTTATTATACTCCTGACTATGAAACCAAAGATACTGATATTTTGGCAGCATTTCGAGTAACTCCTCAACCTGGAGTTCCACCTGAGGAAGCAGGGGCCGCGGTAGCTGCTGAATCTTCTACTGGTACATGGACAACTGTATGGACTGACGGTCTTACCAGTCTTGATCGTTACAAAGGTCGATGCTACCACATCGAGCCTGTTGCTGGAGAAGAAAGTCAATTTATTGCTTATGTAGCTTACCCCTTAGACCTTTTTGAAGAAGGTTCTGTTACTAACATGTTTACTTCCATTGTAGGTAATGTGTTTGGGTTCAAGGCCCTGCGCGCTCTACGTCTGGAGGATTTGCGAATCCCTCCTGCTTATGTTAAAACTTTCCAGGGCCCGCCTCATGGTATCCAAGTTGAGAGAGATAAATTGAACAAGTATGGCCGCCCTCTATTGGGATGTACTATAAAACCAAAATTGGGGTTATCCGCTAAGAATTACGGTAGAGCAGTTTATGAATGTCTA-

amino acid sequence

SVGFKAGVKDYKLTYYTPDYETKDTDILAAFRVTPQPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEESQFIAYVAYPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYVKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECL-

Visual representation of DNA barcode sequence for Saskatoon serviceberry

139/150: The Longnose Gar – Freaky Fish!

Animalia: Chordata: Actinopterygii: Lepisosteiformes: Lepisosteidae: Lepisosteus: Lepisosteus osseus (Linnaeus, 1758)

The longnose gar can be found along the east coast of North and Central America.  It resides in freshwater lakes where there is plenty of vegetation, trees and stone outcrops.  The species is defined by its long snout, sharp teeth, elongated body and earthy colours of brown and white along its sides.  Longnose gar eat almost anything, ranging from other fishes, small insects to a variety of crustaceans. Longnose gars are survivors, this species has persisted over 100 million years and they can tolerate oxygen poor environments. Historically, these fish were caught to serve as a food source for settlers.  Today, the species continues to be fished but mostly for sport fishing as trophy pieces. #Canada150 #Biodiversity150

Specimen BCF-0012-2 – Fleuve St-Laurent, Quebec – 25-Sep-2005. Photo Credit: Royal Ontario Museum
Longnose gar in an aquarium. Photo Credit: Mat1583 goo.gl/ZX6jer

Here’s the barcode sequence information for this species:

Process ID: BCF181-07

nucleotide sequence

CCTTTATATAGTATTTGGTGCCTGAGCCGGAATAGTCGGAACCGCCCTGAGCCTCTTAATTCGAGCAGAACTAAGTCAGCCTGGAACCCTCCTTGGGGATGACCAAATTTATAATGTTATCGTTACAGCGCATGCTTTCGTAATAATTTTCTTTATAGTAATACCAGTTATAATCGGAGGATTTGGCAACTGGCTTGTGCCTCTAATAATCGGCGCCCCTGACATAGCCTTCCCCCGAATAAACAATATAAGCTTCTGACTTCTCCCACCTTCATTTCTTCTACTCCTAGCCTCATCAGGAATTGAAGCAGGGGCCGGAACAGGATGAACAGTCTATCCACCCCTGGCTAGCAATCTCGCACACGCAGGAGCATCAGTTGATCTAACCATTTTCTCCCTTCACTTAGCCGGTATTTCATCAATTCTAGGTGCCATCAATTTTATTACAACAATCCTAAACATGAAGCCACCAGCAGCTTCTCAATACCAAACGCCTCTATTTGTCTGATCTGTCTTAATTACTGCAGTCTTACTATTGCTCTCCCTGCCAGTCCTAGCCGCAGGTATTACGATACTATTAACAGACCGAAACCTTAATACCACCTTCTTTGATCCCGCAGGAGGAGGGGACCCCATTCTCTATCAACACTTA

amino acid sequence

LYMVFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPVMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGIEAGAGTGWTVYPPLASNLAHAGASVDLTIFSLHLAGISSILGAINFITTILNMKPPAASQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL

Visual representation of DNA barcode sequence for Longnose gar

Learn more about it’s BIN (Barcode Index Number): BOLD:AAC8692

136/150: Poach Eggs Not Whitefish

Animalia: Chordata: Actinopterygii: Salmoniformes: Salmonidae: Coregonus: Coregonus huntsmani (W. B. Scott, 1987)

The Atlantic whitefish (Coregonus huntsmani), is native to Nova Scotia, Canada residing in the Tusket River and Petite Riviere. If you see this species, consider yourself lucky. In 1970, under the federal Fisheries Act, the fishing for the species was prohibited. Habitat loss from the damming of the Tusket River contributed to its decline as well as introduced fish species. To this day, it is still considered endangered. The Atlantic whitefish has silver coloured sides and a darkish blue-green back, spawns in freshwater and lives out most of its life in the sea. Its diet consists of amphipods, periwinkles and marine worms. #Canada150 #Biodiversity150

The Atlantic whitefish (Coregonus huntsmani), an endangered species. Photo Credit: Department of Fisheries and Oceans Canada goo.gl/x8k8Ca
Range of the Atlantic whitefish. Photo Credit: Government of Canada goo.gl/GZy7UT

Here’s the barcode sequence information for this species:

Process ID: BCFB943-07

nucleotide sequence

CCTTTATTTAGTATTTGGTGCCTGAGCCGGAATAGTCGGCACAGCCCTAAGCCTTTTAATCCGAGCGGAGCTAAGCCAACCCGGGGCTCTTCTAGGGGATGATCAGATTTATAATGTAATCGTCACGGCCCATGCCTTCGTTATGATTTTCTTTATAGTTATGCCAATTATGATTGGAGGCTTTGGAAACTGATTAATCCCACTTATAATTGGGGCCCCCGACATGGCATTTCCCCGAATGAACAACATGAGCTTTTGGCTCCTTCCCCCATCCTTTCTCCTTCTCCTGGCCTCGTCCGGAGTTGAAGCCGGTGCCGGCACAGGATGAACAGTCTACCCCCCTCTGGCAGGCAACCTCGCCCACGCAGGGGCCTCCGTCGATTTAACTATTTTCTCCCTCCACCTAGCTGGTATTTCCTCTATCTTGGGAGCCGTTAATTTTATTACAACCATTATTAATATGAAACCCCCAGCTATTTCCCAGTATCAAACCCCCCTGTTTGTTTGAGCCGTCTTAATTACCGCAGTCCTCTTACTGCTCTCCCTTCCTGTCCTAGCAGCAGGTATTACCATGCTACTCACAGACCGAAATCTAAACACCACTTTCTTTGACCCAGCAGGCGGGGGAGATCCAATCCTGTATCAACACCTC

amino acid sequence

LYLVFGAWAGMVGTALSLLIRAELSQPGALLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGVEAGAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGISSILGAVNFITTIINMKPPAISQYQTPLFVWAVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL

Visual representation of DNA barcode sequence for Atlantic Whitefish

Learn more about it’s BIN (Barcode Index Number): BOLD:AAI9334