138/150: Lonchopteridae – Flies without fathers


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Insecta: Diptera: Lonchopteridae: Lonchoptera: Lonchoptera bifurcata (Fallen, 1810)

Lonchoptera bifurcata is known as a pointed-winged or spear winged fly with a Holarctic distribution. This means the species is found in all non-tropical regions across North America, Europe, Asia, and Africa! The fly can be distinguished from similar species due to the pale-coloured bristles behind the eye, bristles on the front of the tibiae of the first legs, and the distinct sharply pointed wings. L. bifurcata are found in different areas depending on the life stage. Larvae will be found among decaying organic matter like leaves and logs, while adults are more commonly found in most ditches and damp lawns. What’s interesting is that males of the species are not that commonly found, because of this, females have been found to produce young parthenogenetically where unfertilized eggs develop into live young! #Canada150 #Biodiversity150

Dorsal view of Lonchoptera bifurcata, commonly found in cities across Canada. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Lonchoptera bifurcata posing on a leaf. Photo Credit: Sanja565658 goo.gl/GR4pp1
Lonchoptera bifurcata showing off its wings in Eifel National Park, Germany. Photo Credit: Sarefo goo.gl/w6vULE

Here’s the barcode sequence information for this species:

Process ID: BBDIP089-09

nucleotide sequence

AACTTTATATTTTATTTTTGGAGCTTGAGCAGGAATAGTAGGTACTTCTCTTAGAATTTTAATTCGAGCTGAATTAGGAAATCCAGGAGCTTTAATTGGTGATGATCAAATTTATAATGTGATTGTTACAGCTCATGCTTTTGTAATAATTTTTTTTATAGTTATACCTATTATAATTGGAGGGTTTGGAAATTGATTAGTTCCTTTAATATTAGGAGCACCAGACATAGCATTCCCTCGAATAAATAATATAAGATTTTGAATATTACCTCCATCTTTAACCCTTTTATTAGCCAGTAGTATAGTAGAAAATGGAGCTGGAACAGGATGAACAGTTTATCCTCCTTTATCCTCTGGAATTGCTCATGCTGGAGCATCTGTTGATTTAGCAATTTTTTCATTACATTTAGCTGGAATTTCTTCTATTTTAGGAGCTGTTAATTTTATTACAACTGTTATTAATATACGTTCATCAGGAATAAGTTTTGATCGAATACCTTTATTTGTTTGATCTGTAGTAATTACTGCTTTATTATTATTATTATCTTTACCTGTATTAGCTGGAGCTATCACAATATTATTAACAGATCGAAATTTAAATACTTCTTTTTTTGACCCTGCTGGAGGAGGAGATCCTATTCTTTATCAACATTTATTT

amino acid sequence

TLYFIFGAWAGMVGTSLSILIRAELGNPGALIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWMLPPSLTLLLASSMVENGAGTGWTVYPPLSSGIAHAGASVDLAIFSLHLAGISSILGAVNFITTVINMRSSGMSFDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Lonchoptera bifurcata

Learn more about it’s BIN (Barcode Index Number): BOLD:AAG9974

137/150: Lonely Since 1989


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthopoda: Arachnida: Araneae: Linyphiidae: Gibothorax tchernovi (Eskov, 1989)

Spiders that belong to the group of Linyphiidae are made up of small spiders with more than 4,300 species globally. They are more commonly known as money spiders in the United Kingdom and Australia because they were linked with having good luck. New spiders within this family are still being found as with the case of Gibothorax tchernovi that lives on islands in Canada’s North. The small size of these organisms makes taxonomically classifying them a challenge and species have been divided and regrouped numerous times. The genus Gibothorax still only has one species within its group over a span of 28 years since its initial discovery. Hopefully more spiders under the Gibothorax genus will be discovered, and fingers crossed that they’ll be found in Canada!  #Canada150 #Biodiversity150

CCDB-05148-A09 – Hershel Island, Yukon Territory – 04-Jul-2007. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Example habitat where G. tchernovi can be found. Photo Credit: Kiril Strax goo.gl/mHfpSH

Here’s the barcode sequence information for this species:

Process ID: SPIAI864-10

nucleotide sequence

AAGTTTATATTTTATTTTTGGGGCATGGGCTGCTATAGTAGGGACAGCAATAAGAGTGTTAATTCGAATTGAGTTAGGGCAAACTGGTAGATTATTAGGGGATGATCAATTGTATAATGTAATTGTTACTGCTCATGCGTTTATTATGATTTTTTTTATAGTTATACCTATTTTGATTGGGGGATTTGGAAATTGGTTAGTCCCATTAATATTAGGGGCACCGGATATGGCTTTCCCACGAATAAATAATTTAAGTTTTTGGTTATTACCCCCTTCTTTATTATTATTGTTTATTTCTAGAATGGATGAAATAGGGGTAGGAGCTGGATGAACTATTTATCCTCCTCTTGCTTCTTTGGAGGGGCATTCTGGAAGTTCAGTAGATTTTGCTATTTTTTCTTTGCATTTGGCTGGGGCTTCTTCAATTATAGGGGCTATTAATTTTATTTCTACTATTTTGAATATACGAGGTTATGGAATAACTATAGAAAAAGTACCTTTATTTGTTTGGTCTGTTTTAATTACAGCTGTATTATTATTATTATCTTTACCTGTTTTAGCAGGTGCTATTACTATGCTTTTAACTGATCGAAATTTTAATACTTCATTTTTTGATCCTTCTGGAGGAGGGGATCCAGTATTATTTCAACATTTATTT

amino acid sequence

SLYFIFGAWAAMVGTAMSVLIRIELGQTGSLLGDDQLYNVIVTAHAFIMIFFMVMPILIGGFGNWLVPLMLGAPDMAFPRMNNLSFWLLPPSLLLLFISSMDEMGVGAGWTIYPPLASLEGHSGSSVDFAIFSLHLAGASSIMGAINFISTILNMRGYGMTMEKVPLFVWSVLITAVLLLLSLPVLAGAITMLLTDRNFNTSFFDPSGGGDPVLFQHLF

Visual representation of DNA barcode sequence for Gibothorax tchernovi

Learn more about it’s BIN (Barcode Index Number): BOLD:AAG5706