Animalia: Arthropoda: Collembola: Entomobryomorpha: Entomobryidae: Entomobrya: Entomobrya gisini (Christiansen, 1958)

Slender springtails are tiny, abundant organisms that are less than 1 cm long. There can be thousands of springtails within a square meter of soil. They live in damp habitats and can be found in soil, leaf litter, rotting logs, and sometimes you may see them in your home. They are harmless and only eat decaying organic matter, fungus, and algae. These springtails are distinctly different from the round, stout springtails in that slender springtails look more like a grain of rice. All springtails possess a furculum and a collophore. The furculum, their spring tail, tucks under their body and acts as a catapult that can launch a springtail several inches forward. The collophore is a tube structure on the ventral side of the abdomen that was thought to aid the animal in sticking to surfaces but is now believed to play a role in osmoregulation. #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID: CNJAD1685-12

nucleotide sequence

GACTTTATATCTTATTTTTGGTGTTTGAGCAGCTATAGTAGGTACAGCTTTCAGAGTGTTAATCCGATTAGAATTAGGACAACCAGGAAGATTTATTGGAGATGATCAAATTTATAACGTTATGGTAACTGCCCACGCTTTTATCATAATTTTTTTTATAGTTATACCGATTATAATTGGAGGATTTGGTAATTGACTAATTCCTTTAATAATTGGCGCCCCCGATATAGCTTTCCCTCGAATAAATAATATGAGCTTTTGACTCCTACCTCCATCTCTTACACTACTTTTAACAGGAGGGTTAGTAGAAAGAGGAGCCGGTACAGGATGAACAGTCTACCCCCCTCTAGCTAGAGGACTAGCTCATTCTGGCGCTTCTGTAGACCTATCAATCTTTAGCCTGCACTTAGCTGGTGCTTCTTCTATTTTAGGAGCTGTAAATTTTATTACAACAATTATTAATATACGAGCCCCTGGTATATATTGAGACCAAACCCCGCTATTTGTTTGATCAGTATTCTTAACTGCTATTTTGCTCCTTTTATCTTTACCTGTTTTAGCTGGAGCTATCACAATATTACTAACAGATCGTAACTTAAATACAACATTTTTTGATCCCGCTGGAGG

amino acid sequence

TLYLIFGVWAAMVGTAFSVLIRLELGQPGSFIGDDQIYNVMVTAHAFIMIFFMVMPIMIGGFGNWLIPLMIGAPDMAFPRMNNMSFWLLPPSLTLLLTGGLVESGAGTGWTVYPPLASGLAHSGASVDLSIFSLHLAGASSILGAVNFITTIINMRAPGMYWDQTPLFVWSVFLTAILLLLSLPVLAGAITMLLTDRNLNTTFFDPAGX

Learn more about it’s BIN (Barcode Index Number): BOLD:AAA7239