Tag: Archaeognatha

130/150: They may not have wings, but boy can they jump!

Posted on by Jude Frie
Animalia: Arthropoda: Insecta: Archaeognatha: Machilidae: Petrobiinae: Pedetontus: Pedetontus submutans (Silvestri, 1911)

The jumping bristletails belong to the order Archaeognatha. These small insects exhibit three pronged tails, an arched back, and two compound eyes. Its body is covered in detached scales making it very hard for predators to grip. Living in diverse habitats from moist shorelines to dry deserts, the jumping bristletails are well adapted for many environments having evolved eversible moisture absorbing vesicles. They are known for their quick movements and ability to jump over 25 cm at a time. These fast moving hexapods don’t even have to meet their mates. Instead the males leave their spermatophore out in the open, attaching silken threads for the females to find and follow. #Canada150 #Biodiversity150

Specimen 10BBSIO-0199 – Willowbrae Trail, Pacific Rim NP, British Columbia – 03-Jul-2010 -Free Hand. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Jumping Bristletail, Pedetontus submutans, on the tip of an index finger. Photo Credit: Keith Roragen goo.gl/cG9aDB
Jumping Bristletail, Pedetontus submutans, in a mossy forest environment. Photo Credit: Shipher Wu goo.gl/fqEvSF

Here’s the barcode sequence information for this species:

Process ID: SIOCA199-10

nucleotide sequence

CACTCTTTACCTTATTTTCGGAGTTTGAGCAGGTTTAGTAGGAACTTCCTTAAGTATTTTAATTCGAGCTGAACTAGGTCAACCAGGAAGTCTAATTGGCGATGATCAAATTTACAATGTTATCGTTACAGCTCATGCATTCATTATAATTTTTTTTATAGTAATACCTATTATAATTGGAGGTTTTGGTAATTGATTAGTACCATTAATATTAGGTGCCCCCGATATAGCATTTCCACGACTTAATAATATAAGTTTCTGATTATTACCTCCTTCCTTACTATTACTATTAAGAGGAAGTATTGTTGAAAATGGAGCAGGTACAGGATGAACAGTGTATCCTCCCTTATCAAGAGGGATAGCCCATGCTGGAGGATCCGTAGATTTATCTATTTTTTCCCTACATTTAGCAGGTGCTTCAAGAATCTTAGGTGCAGCTAACTTCATTACAACAGTAATTAATATACGCCCAAGAGGAATAACCTTAGATCGAATACCTCTTTTTGTTTGATCCGTATTAATTACAGCTATCCTATTATTATTATCTCTTCCTGTATTAGCAGGTGCAATTACAATACTCCTTACAGACCGAAATTTAAATACCTCATTTTTTGATCCTGCTGGAGGGGGAGATCCTATTTTATACCAACATTTATTT

amino acid sequence

TLYLIFGVWAGLVGTSLSILIRAELGQPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLLLLLSGSIVENGAGTGWTVYPPLSSGMAHAGGSVDLSIFSLHLAGASSILGAANFITTVINMRPSGMTLDRMPLFVWSVLITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Jumping bristletail

Learn more about it’s BIN (Barcode Index Number): BOLD:AAV1528