150/150: Home is where the heart is for the Barred Owl


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Chordata: Aves: Strigiformes: Strigidae: Strix: Strix varia Barton, 1799

The Barred Owl is a member of the family Strigidae, the true owls, which it shares with almost all other extant owl species. It is also called the Hoot Owl due to its characteristic mating call. Like most owls, Barred Owls are silent when hunting and possess wing adaptions that enhance their ability to sneak up on prey. The Barred Owl mostly preys on small mammals and has occasionally been known to wade into water to fish for food within wetland habitats. Continue reading “150/150: Home is where the heart is for the Barred Owl”

134/150: A soaring hawk of the prairies


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Chordata: Aves: Accipitriformes: Accipitridae: Buteo: Buteo regalis (Gray, 1844)

The Ferruginous Hawk is the largest hawk native to North America and is a specialist predator, feeding on specific rodent species. It is classified as Threatened by the Committee on the Status of Endangered Wildlife in Canada (COSEWIC) due to the loss and fragmentation of its breeding habitat, the prairies of Canada. With an estimated population of 1200 breeding pairs, efforts are being made to reduce habitat loss.

Hawk refers to diurnal (active by day) predatory birds. Hawks are considered among the most intelligent birds, as having one of the best eyesight in the animal kingdom (eight times better than us!). They can see ultra-violet light and can detect polarized light or magnetic fields. Hawks can reach diving speeds of over 240 km an hour and undertake long migrations, travelling thousands of miles a year. Hawk couples are monogamous, usually mating for life.  #Canada150 #Biodiversity150

The Ferruginous Hawk (Buteo regalis). Photo Credit: Tony Hisgett goo.gl/LbKqFD
The Ferruginous Hawk, looking fierce. Photo Credit: Tim Sträter goo.gl/2NcyZY
A Ferruginous Hawk perched on a fence. Photo Credit: Dick Daniels goo.gl/iGWyAn
A Ferruginous Hawk soaring through the sky. Photo Credit: Shravans14 goo.gl/e9CWvc

Here’s the barcode sequence information for this species:

Process ID: KBNA789-04

nucleotide sequence

CCTATACCTAATCTTCGGTGCCTGAGCCGGTANAGTCGGCACCGCCCTCAGCCTACTTATTCGCGCAGAACTCGGCCAACCAGGCACACTCCTAGGTGATGACCAGATCTACAACGTAATCGTTACCGCACATGCCTTCGTAATAATTTTCTTTATAGTTATACCAATTATGATCGGAGGCTTCGGAAACTGACTTGTTCCACTCATAATCGGCGCCCCCGACATAGCCTTCCCACGCATAAACAACATAAGCTTCTGACTACTTCCTCCATCCTTTCTCCTCCTCCTAGCCTCCTCAACAGTAGAAGCAGGAGCTGGCACTGGATGAACTGTCTATCCCCCACTAGCTGGTAACATAGCCCATGCCGGAGCTTCAGTAGACCTAGCTATCTTCTCCCTACACTTAGCCGGAGTCTCGTCCATTCTAGGAGCAATCAACTTTATCACAACCGCCATCAACATAAAGCCCCCAGCTCTCTCCCAATATCAAACACCCCTATTCGTATGATCTGTCCTCATTACCGCTGTCCTTCTACTACTTTCACTCCCAGTCCTAGCCGCCGGCATTACCATACTACTTACAGACCGAAACCTAAACACAACATTCTTTGACCCCGCCGGCGGAGGTGACCCCATCCTATACC

amino acid sequence

LYLIFGAWAGXVGTALSLLIRAELGQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSTVEAGAGTGWTVYPPLAGNMAHAGASVDLAIFSLHLAGVSSILGAINFITTAINMKPPALSQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYX

Visual representation of DNA barcode sequence for Ferruginous Hawk

Learn more about it’s BIN (Barcode Index Number): BOLD:ABZ1637

103/150: National Hummingbird Day – The Calliope Hummingbird


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Chordata: Aves: Apodiformes: Trochilidae: Selasphorus: Selasphorus calliope (Gould, 1847)

The first Saturday in September is being celebrated as National Hummingbird Day. Read on to learn more about the Calliope hummingbird. These birds are spunky, territorial, and have the nerve to chase away hawks while resembling the size of a ping pong ball! Continue reading “103/150: National Hummingbird Day – The Calliope Hummingbird”

49/150: BEHOLD! The longest migration of any bird, The Arctic Tern


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Chordata: Aves: Charadriformes: Laridae: Sterna: Sterna paradisaea (Pontoppidan, 1763)

The Arctic Tern (Sterna paradisaea) is a winter, sea-faring bird with the longest yearly migration of any known species. They will travel a total of 70,900 km in one year from their breeding site in Northern Canada and Europe to their winter home near Antarctica. Continue reading “49/150: BEHOLD! The longest migration of any bird, The Arctic Tern”