89/150: Bizarre parenting brought to you by the Bot Fly


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Insecta: Diptera: Oestridae: Cuterebra: Cuterebra fontinella (Clark, 1827)

Nothing says parenting like leaving your young in the flesh of mammals to grow up. Members of the genus Cuterebra can be found parasitizing different hosts, but they all share the same process of parasitism. Adult bot flies are non-feeding with vestigial mouthparts that evolution rendered unusable. That leaves mating as their main goal for their life stage. Males wait for females and will mate with them in air. Females locate an area where hosts visit frequently through chemical cues, and will lay around 1200-4000 eggs. Being able to respond to changes in temperature and carbon dioxide concentrations, the larvae will hatch in response to the presence of a host, and aim to enter the host through the nostrils or open wounds. Once in a host, larvae will go through many stages of growth called instars and then drop out of the host and pupate in the ground. Finally, they emerge as adults ready to start the process again. #Canada150 #Biodiversity150

An adult Cuterebra fontinella. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
A Cuterebra larva that would typically be found within the skin of mice and other rodents. Photo Credit: Sean McCann goo.gl/G8f53g

Here’s the barcode sequence information for this species:

Process ID:  BBDEC095-09

nucleotide sequence

AACATTATATTTTATTTTTGGAGCTTGATCTGGAATAGTAGGAACTTCTTTAAGTATACTTATTCGAGCAGAACTAGGACACCCAGGAGCACTAATTGGAGACGATCAAATTTACAATGTTATTGTAACAGCTCATGCTTTTATTATAATTTTTTTTATAGTTATACCAATTATAATTGGAGGATTTGGTAATTGACTAGTACCATTAATATTAGGAGCTCCTGATATAGCATTCCCACGTATAAATAATATAAGTTTTTGACTACTACCTCCATCTCTAACACTTTTATTGGTAAGAAGTATAGTAGAAAACGGAGCTGGTACAGGATGAACCGTTTACCCTCCCCTATCATCTAATATCGCTCACGGAGGAGCTTCTGTAGATTTAGCTATTTTTTCACTACATTTAGCTGGAATTTCATCTATTCTAGGTGCTGTAAATTTTATCACCACAGTAATTAACATACGATCAACAGGAATTACATTTGATCGAATACCCTTATTTGTTTGATCAGTAGTTATTACAGCATTACTATTACTTTTATCATTACCAGTTTTAGCCGGAGCTATTACTATACTTTTAACCGATCGAAACCTAAACACCTCATTTTTTGACCCAGCTGGAGGTGGAGACCCAATTTTATACCAACATTTATTC

amino acid sequence

TLYFIFGAWSGMVGTSLSMLIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLVSSMVENGAGTGWTVYPPLSSNIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGITFDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Bot Fly

Learn more about it’s BIN (Barcode Index Number): BOLD:AAH0836

73/150: Dragons of the Forest


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Insecta: Hymenoptera: Ichneumonidae: Rhyssinae: Megarhyssa: Megarhyssa atrata (Fabricius, 1781)

At first glance, Megarhyssa atrata may slightly resemble small dragons due to their extremely long ovipositor! They can be found from May to June in North America, ranging all the way from Quebec to Florida. The Megarhyssa genus is known to have species with the longest ovipositors ever recorded in the insect world. Continue reading “73/150: Dragons of the Forest”