Animalia: Arthropoda: Insecta: Diptera: Oestridae: Cuterebra: Cuterebra fontinella (Clark, 1827)
Nothing says parenting like leaving your young in the flesh of mammals to grow up. Members of the genus Cuterebra can be found parasitizing different hosts, but they all share the same process of parasitism. Adult bot flies are non-feeding with vestigial mouthparts that evolution rendered unusable. That leaves mating as their main goal for their life stage. Males wait for females and will mate with them in air. Females locate an area where hosts visit frequently through chemical cues, and will lay around 1200-4000 eggs. Being able to respond to changes in temperature and carbon dioxide concentrations, the larvae will hatch in response to the presence of a host, and aim to enter the host through the nostrils or open wounds. Once in a host, larvae will go through many stages of growth called instars and then drop out of the host and pupate in the ground. Finally, they emerge as adults ready to start the process again. #Canada150 #Biodiversity150


Here’s the barcode sequence information for this species:
Process ID: BBDEC095-09
nucleotide sequence
AACATTATATTTTATTTTTGGAGCTTGATCTGGAATAGTAGGAACTTCTTTAAGTATACTTATTCGAGCAGAACTAGGACACCCAGGAGCACTAATTGGAGACGATCAAATTTACAATGTTATTGTAACAGCTCATGCTTTTATTATAATTTTTTTTATAGTTATACCAATTATAATTGGAGGATTTGGTAATTGACTAGTACCATTAATATTAGGAGCTCCTGATATAGCATTCCCACGTATAAATAATATAAGTTTTTGACTACTACCTCCATCTCTAACACTTTTATTGGTAAGAAGTATAGTAGAAAACGGAGCTGGTACAGGATGAACCGTTTACCCTCCCCTATCATCTAATATCGCTCACGGAGGAGCTTCTGTAGATTTAGCTATTTTTTCACTACATTTAGCTGGAATTTCATCTATTCTAGGTGCTGTAAATTTTATCACCACAGTAATTAACATACGATCAACAGGAATTACATTTGATCGAATACCCTTATTTGTTTGATCAGTAGTTATTACAGCATTACTATTACTTTTATCATTACCAGTTTTAGCCGGAGCTATTACTATACTTTTAACCGATCGAAACCTAAACACCTCATTTTTTGACCCAGCTGGAGGTGGAGACCCAATTTTATACCAACATTTATTC
amino acid sequence
TLYFIFGAWSGMVGTSLSMLIRAELGHPGALIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRMNNMSFWLLPPSLTLLLVSSMVENGAGTGWTVYPPLSSNIAHGGASVDLAIFSLHLAGISSILGAVNFITTVINMRSTGITFDRMPLFVWSVVITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF
Learn more about it’s BIN (Barcode Index Number): BOLD:AAH0836