94/150: O Canada Darner!


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Insecta: Odonata: Aeshnidae: Aeshna: Aeshna canadensis Walker, 1908

A real Canadian dragonfly, the Canada darner Aeshna canadensis is native to all ten Canadian provinces. Ranging from a brilliant blue to a rich brown in colour, Canada darner males are usually seen hovering near edges of boggy freshwater habitats, whereas the milder coloured females (who can come in blue, green or yellow) tend to be seen near forested areas or fields. Dragonflies are not just a beautiful sight to be seen. In fact, the presence of dragonflies near a beaver pond or lake – alongside the presence of damselflies and mayflies – is an indicator of a healthy and biodiverse aquatic ecosystem! Not only that, but dragonflies are very sensitive to global climate change – which means that by observing changes in their populations it can indicate changes in climate. Keep an eye out for these important insects on your next hike and see if you are passing by a healthy ecosystem, or one that may be affected strongly by changing temperatures. #Canada150 #Biodiversity150

A Canada darner in flight. Photo Credit: Gary Yankech goo.gl/i6Ga2
The colourful patterns of the Canada darner. Photo Credit: Mike Ostrowski goo.gl/BKAn2V

Here’s the barcode sequence information for this species:

Process ID: ODSO720-08

nucleotide sequence

AACACTTTATTTTTTATTTGGGGCATGATCAGGAATAGTAGGAACTGCTTTAAGAGTTCTAATTCGAATTGAATTAGGACAACCAGGATCATTAATTGGAGATGATCAAATTTATAATGTAATTGTAACAGCACATGCTTTTGTTATAATTTTCTTTATAGTGATACCTATTATAATTGGAGGATTCGGGAATTGGTTAGTACCACTAATATTAGGAGCTCCTGATATAGCTTTCCCACGTTTAAATAATATAAGATTTTGATTGTTACCTCCTTCATTAACACTATTATTAGCAGGAAGTATGGTTGAAAGAGGAGCCGGAACAGGTTGAACTGTATATCCACCTCTAGCTGGTGCAATTGCTCATGCAGGAGCATCAGTAGATTTAACTATTTTTTCTTTACATCTGGCTGGAGTATCTTCAATTTTAGGGGCTATTAATTTTATTACTACAACAATTAATATAAAGTCACCAGGAATAAAGATAGATCAAATACCTCTTTTTGTATGAGCTGTTGTAATTACAGCTGTACTTTTATTACTTTCTTTACCAGTTCTTGCTGGAGCAATTACTATACTCTTAACAGATCGAAATATTAATACATCATTTTTTGATCCAGCAGGAGGAGGAGATCCTATTTTATATCAACACTTATTC

amino acid sequence

TLYFLFGAWSGMVGTALSVLIRIELGQPGSLIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLTLLLAGSMVESGAGTGWTVYPPLAGAIAHAGASVDLTIFSLHLAGVSSILGAINFITTTINMKSPGMKMDQMPLFVWAVVITAVLLLLSLPVLAGAITMLLTDRNINTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Canada Darner

Learn more about it’s BIN (Barcode Index Number): BOLD:ABU7323

Title Image: Specimen ODSO720-08 – Riding Mountain National Park, Manitoba – 12-Aug-2008
Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics

Oodles of Odonates at Awenda Provincial Park


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

This past week, the BIObus visited Georgian Bay Islands, Six Mile Lake, and finally Awenda Provincial Park, nestled at the tip of the Penetanguishene (meaning “land of white, rolling sands”) Peninsula in Georgian Bay.  This park has both a rich geological as well as cultural history, with the area having been inhabited by humans as far back as 11,000 years ago.  Continue reading “Oodles of Odonates at Awenda Provincial Park”

Quills and Dragon Hunters


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Hello again! Last week the BIObus headed up north to Balsam Lake and Indian Point Provincial Parks to complete some aquatic and soil sampling. Field work is considerably different than working in the archive. Continue reading “Quills and Dragon Hunters”

The Real Damsels And Dragons Of Ontario


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Hello again faithful readers,

Last week I returned to the BIObus for more aquatic sampling.  This time we visited sites within the Backus Heritage Conservation Area, Long Point Provincial Park, and the Nature Conservancy of Canada (N.C.C.). Today I’ll be talking about the river damselflies that were almost ubiquitous across our sampling areas and some details about our time in Long Point and the N.C.C. Continue reading “The Real Damsels And Dragons Of Ontario”

Keeping Your Balance In A Stratified Ecosystem


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Hello faithful readers!

Last week I was on the BIObus in several lovely Canadian parks where our team focused on aquatic collections. We got to tramp around in various rivers, bogs, fens, swamps and shorelines in our hip waders, scooping up bugs with our D-nets. This trip, along with many others that will take place this summer, will help BIO add a new level of aquatic invertebrates to the reference library. Continue reading “Keeping Your Balance In A Stratified Ecosystem”

Downpours in Darkwoods


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Something we have all taken for granted the past six weeks was the weather. Thus far on our trip we have had amazing weather…very little rain, lots of sunshine. We had to work in a little drizzle a few times and we had to deal with some wet vegetation but that was the worst of it. So the weather in Darkwoods was a bit of a change for us. Continue reading “Downpours in Darkwoods”

Rocky Start to ‘Rootine’ Work


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Greetings blog browsers. So our week of sampling at scenic Glacier National park is just starting up! The end of our entire trip is starting to come into sight, only 2 parks left. Glacier National Park is absolutely great, from the pristine cold fresh running rivers, the diverse habitats at our disposal for sampling, and the great mountain views. Our campsite was in my opinion is the best we have had thus far. Continue reading “Rocky Start to ‘Rootine’ Work”

Collecting!… I can at Kinaskan


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

So it has been a somewhat interesting past week, with some unexpected bumps in the road. During our time at the beautiful Kluane National Park, I started to notice a little sore spot in my mouth. To be more specific the gum area around one of my wisdom teeth. However this did not really bother me too much as my mind was enveloped by the magnificent landscape, and the work at hand. Continue reading “Collecting!… I can at Kinaskan”

Outreach and Odonates


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Hello again! Today was our second last day on Pender Island, and we spent it mostly doing outreach in various places. Our time at the park has been fantastic, and I would have to say that it is my favourite park so far. The small island community of about 3,000 people has shown itself to be friendly and trustworthy. Continue reading “Outreach and Odonates”

Aquatic Sampling at the Beaver Pond


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

E. C. Manning Provincial Park is a unique and beautiful park located in the Cascade Mountains of southwestern British Columbia. Established in 1941, the park consists of over 65,000 hectares of rugged forest-clad mountains, deep valleys, subalpine meadows, sun dappled lakes, and rushing white water. Continue reading “Aquatic Sampling at the Beaver Pond”