Animalia: Chordata: Actinopterygii: Lepisosteiformes: Lepisosteidae: Lepisosteus: Lepisosteus osseus (Linnaeus, 1758)
The longnose gar can be found along the east coast of North and Central America. It resides in freshwater lakes where there is plenty of vegetation, trees and stone outcrops. The species is defined by its long snout, sharp teeth, elongated body and earthy colours of brown and white along its sides. Longnose gar eat almost anything, ranging from other fishes, small insects to a variety of crustaceans. Longnose gars are survivors, this species has persisted over 100 million years and they can tolerate oxygen poor environments. Historically, these fish were caught to serve as a food source for settlers. Today, the species continues to be fished but mostly for sport fishing as trophy pieces. #Canada150 #Biodiversity150


Here’s the barcode sequence information for this species:
Process ID: BCF181-07
nucleotide sequence
CCTTTATATAGTATTTGGTGCCTGAGCCGGAATAGTCGGAACCGCCCTGAGCCTCTTAATTCGAGCAGAACTAAGTCAGCCTGGAACCCTCCTTGGGGATGACCAAATTTATAATGTTATCGTTACAGCGCATGCTTTCGTAATAATTTTCTTTATAGTAATACCAGTTATAATCGGAGGATTTGGCAACTGGCTTGTGCCTCTAATAATCGGCGCCCCTGACATAGCCTTCCCCCGAATAAACAATATAAGCTTCTGACTTCTCCCACCTTCATTTCTTCTACTCCTAGCCTCATCAGGAATTGAAGCAGGGGCCGGAACAGGATGAACAGTCTATCCACCCCTGGCTAGCAATCTCGCACACGCAGGAGCATCAGTTGATCTAACCATTTTCTCCCTTCACTTAGCCGGTATTTCATCAATTCTAGGTGCCATCAATTTTATTACAACAATCCTAAACATGAAGCCACCAGCAGCTTCTCAATACCAAACGCCTCTATTTGTCTGATCTGTCTTAATTACTGCAGTCTTACTATTGCTCTCCCTGCCAGTCCTAGCCGCAGGTATTACGATACTATTAACAGACCGAAACCTTAATACCACCTTCTTTGATCCCGCAGGAGGAGGGGACCCCATTCTCTATCAACACTTA
amino acid sequence
LYMVFGAWAGMVGTALSLLIRAELSQPGTLLGDDQIYNVIVTAHAFVMIFFMVMPVMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSGIEAGAGTGWTVYPPLASNLAHAGASVDLTIFSLHLAGISSILGAINFITTILNMKPPAASQYQTPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHL
Learn more about it’s BIN (Barcode Index Number): BOLD:AAC8692