130/150: They may not have wings, but boy can they jump!


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Insecta: Archaeognatha: Machilidae: Petrobiinae: Pedetontus: Pedetontus submutans (Silvestri, 1911)

The jumping bristletails belong to the order Archaeognatha. These small insects exhibit three pronged tails, an arched back, and two compound eyes. Its body is covered in detached scales making it very hard for predators to grip. Living in diverse habitats from moist shorelines to dry deserts, the jumping bristletails are well adapted for many environments having evolved eversible moisture absorbing vesicles. They are known for their quick movements and ability to jump over 25 cm at a time. These fast moving hexapods don’t even have to meet their mates. Instead the males leave their spermatophore out in the open, attaching silken threads for the females to find and follow. #Canada150 #Biodiversity150

Specimen 10BBSIO-0199 – Willowbrae Trail, Pacific Rim NP, British Columbia – 03-Jul-2010 -Free Hand. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Jumping Bristletail, Pedetontus submutans, on the tip of an index finger. Photo Credit: Keith Roragen goo.gl/cG9aDB
Jumping Bristletail, Pedetontus submutans, in a mossy forest environment. Photo Credit: Shipher Wu goo.gl/fqEvSF

Here’s the barcode sequence information for this species:

Process ID: SIOCA199-10

nucleotide sequence

CACTCTTTACCTTATTTTCGGAGTTTGAGCAGGTTTAGTAGGAACTTCCTTAAGTATTTTAATTCGAGCTGAACTAGGTCAACCAGGAAGTCTAATTGGCGATGATCAAATTTACAATGTTATCGTTACAGCTCATGCATTCATTATAATTTTTTTTATAGTAATACCTATTATAATTGGAGGTTTTGGTAATTGATTAGTACCATTAATATTAGGTGCCCCCGATATAGCATTTCCACGACTTAATAATATAAGTTTCTGATTATTACCTCCTTCCTTACTATTACTATTAAGAGGAAGTATTGTTGAAAATGGAGCAGGTACAGGATGAACAGTGTATCCTCCCTTATCAAGAGGGATAGCCCATGCTGGAGGATCCGTAGATTTATCTATTTTTTCCCTACATTTAGCAGGTGCTTCAAGAATCTTAGGTGCAGCTAACTTCATTACAACAGTAATTAATATACGCCCAAGAGGAATAACCTTAGATCGAATACCTCTTTTTGTTTGATCCGTATTAATTACAGCTATCCTATTATTATTATCTCTTCCTGTATTAGCAGGTGCAATTACAATACTCCTTACAGACCGAAATTTAAATACCTCATTTTTTGATCCTGCTGGAGGGGGAGATCCTATTTTATACCAACATTTATTT

amino acid sequence

TLYLIFGVWAGLVGTSLSILIRAELGQPGSLIGDDQIYNVIVTAHAFIMIFFMVMPIMIGGFGNWLVPLMLGAPDMAFPRLNNMSFWLLPPSLLLLLSGSIVENGAGTGWTVYPPLSSGMAHAGGSVDLSIFSLHLAGASSILGAANFITTVINMRPSGMTLDRMPLFVWSVLITAILLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Visual representation of DNA barcode sequence for Jumping bristletail

Learn more about it’s BIN (Barcode Index Number): BOLD:AAV1528

 

 

 

78/150: Jumping bloodsuckers Batman! It’s a flea!


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Insecta: Siphonaptera: Ceratophyllidae: Ceratophyllinae: Ceratophyllus: Ceratophyllus vison (Baker, 1904)

This species of flea is an ectoparasitic insect of squirrels, living on red squirrels east of the Rocky Mountains and Douglas squirrels to the west. Being an ectoparasite means that they live on a host, so fleas have evolved particular features that help them live such a lifestyle, such as a loss of wing development, strong claws for grasping onto the host, and a laterally flattened body to move through the hair or fur. Continue reading “78/150: Jumping bloodsuckers Batman! It’s a flea!”