Animalia: Arthropoda: Insecta: Dermaptera: Forficulidae: Forficula auricularia (Linnaeus, 1758)

The European earwig is an introduced species, as you may have guessed from its common name. This insect is known as a household pest and with omnivorous eating habits can either be found eating your grains & vegetables, or other smaller insect pests. Despite popular stories, earwigs do not crawl into your ears while you sleep, and they don’t bore into your brain as thought by many people. Unlike most insects, European earwigs display parental care. Once the females lay eggs, they place all of them in a hole and stand over it, protecting them from predators. Females also monitor mold growth and move the eggs around in the hole. Females are known to produce two broods of eggs, the first typically is around 30 to 60 eggs, with the second being around half of that or less. Eggs laid in colder weather typically take around 70 days to hatch, while ones in warmer weather only take around 20 days. #Canada150 #Biodiversity150

Here’s the barcode sequence information for this species:

Process ID: SIOCN019-10

nucleotide sequence

AACTTTATATTTTGTATTTGGGGCTTGATCAGGAATAGTGGGGACTTCATTGAGCTTGTTGATTCGGGCAGAATTGGGCCAACCTGGAGCTTTAATCGGAGATGATCAAATTTATAATGTAATTGTTACGGCCCATGCTTTTGTAATGATTTTTTTTATGGTAATGCCTATTATGATTGGAGGTTTTGGGAATTGACTGGTACCTTTGATGTTGAGAGCCCCAGATATGGCCTTTCCCCGAATAAACAACATGAGTTTTTGGTTACTACCCCCTTCGCTTATGCTTTTGCTTTCTGGGAGTATGGTAGATAGAGGAGCTGGTACAGGTTGGACAGTTTACCCCCCTTTGTCGGGGGCCATCGCCCACGCAGGGGCTTCGGTAGATTTGAGTATTTTTTCATTGCATTTGGCAGGGATTTCATCAATTTTGGGGGCAATTAATTTTATCACAACGGTGATTAATATGCGCCCATCGGGCCTTAAGCTGGAACGAATACCGTTGTTTGTATGATCCGTAGCCATTACTGCTCTTTTATTGTTGCTTTCTTTGCCAGTATTGGCAGGGGCTATCACTATGCTTTTGACGGACCGGAACTTAAATACATCTTTTTTCGACCCTGCGGGAGGGGGGGACCCCATTCTTTATCAACATTTATTT

amino acid sequence

TLYFVFGAWSGMVGTSLSLLIRAELGQPGALIGDDQIYNVIVTAHAFVMIFFMVMPIMIGGFGNWLVPLMLSAPDMAFPRMNNMSFWLLPPSLMLLLSGSMVDSGAGTGWTVYPPLSGAIAHAGASVDLSIFSLHLAGISSILGAINFITTVINMRPSGLKLERMPLFVWSVAITALLLLLSLPVLAGAITMLLTDRNLNTSFFDPAGGGDPILYQHLF

Learn more about it’s BIN (Barcode Index Number): BOLD:AAG9897