137/150: Lonely Since 1989


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthopoda: Arachnida: Araneae: Linyphiidae: Gibothorax tchernovi (Eskov, 1989)

Spiders that belong to the group of Linyphiidae are made up of small spiders with more than 4,300 species globally. They are more commonly known as money spiders in the United Kingdom and Australia because they were linked with having good luck. New spiders within this family are still being found as with the case of Gibothorax tchernovi that lives on islands in Canada’s North. The small size of these organisms makes taxonomically classifying them a challenge and species have been divided and regrouped numerous times. The genus Gibothorax still only has one species within its group over a span of 28 years since its initial discovery. Hopefully more spiders under the Gibothorax genus will be discovered, and fingers crossed that they’ll be found in Canada!  #Canada150 #Biodiversity150

CCDB-05148-A09 – Hershel Island, Yukon Territory – 04-Jul-2007. Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics
Example habitat where G. tchernovi can be found. Photo Credit: Kiril Strax goo.gl/mHfpSH

Here’s the barcode sequence information for this species:

Process ID: SPIAI864-10

nucleotide sequence

AAGTTTATATTTTATTTTTGGGGCATGGGCTGCTATAGTAGGGACAGCAATAAGAGTGTTAATTCGAATTGAGTTAGGGCAAACTGGTAGATTATTAGGGGATGATCAATTGTATAATGTAATTGTTACTGCTCATGCGTTTATTATGATTTTTTTTATAGTTATACCTATTTTGATTGGGGGATTTGGAAATTGGTTAGTCCCATTAATATTAGGGGCACCGGATATGGCTTTCCCACGAATAAATAATTTAAGTTTTTGGTTATTACCCCCTTCTTTATTATTATTGTTTATTTCTAGAATGGATGAAATAGGGGTAGGAGCTGGATGAACTATTTATCCTCCTCTTGCTTCTTTGGAGGGGCATTCTGGAAGTTCAGTAGATTTTGCTATTTTTTCTTTGCATTTGGCTGGGGCTTCTTCAATTATAGGGGCTATTAATTTTATTTCTACTATTTTGAATATACGAGGTTATGGAATAACTATAGAAAAAGTACCTTTATTTGTTTGGTCTGTTTTAATTACAGCTGTATTATTATTATTATCTTTACCTGTTTTAGCAGGTGCTATTACTATGCTTTTAACTGATCGAAATTTTAATACTTCATTTTTTGATCCTTCTGGAGGAGGGGATCCAGTATTATTTCAACATTTATTT

amino acid sequence

SLYFIFGAWAAMVGTAMSVLIRIELGQTGSLLGDDQLYNVIVTAHAFIMIFFMVMPILIGGFGNWLVPLMLGAPDMAFPRMNNLSFWLLPPSLLLLFISSMDEMGVGAGWTIYPPLASLEGHSGSSVDFAIFSLHLAGASSIMGAINFISTILNMRGYGMTMEKVPLFVWSVLITAVLLLLSLPVLAGAITMLLTDRNFNTSFFDPSGGGDPVLFQHLF

Visual representation of DNA barcode sequence for Gibothorax tchernovi

Learn more about it’s BIN (Barcode Index Number): BOLD:AAG5706

113/150: A Wolf Spider Like No Other


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Arachnida: Araneae: Lycosidae: Alopecosa: Alopecosa koponeni sp. n. (Sundevall 1833, Simon 1885, and Blagoev & Dondale 2014)

Alopecosa koponeni sp. n. is a new species described in 2014 from the arctic tundra in the vicinity of Churchill, Manitoba! It was discovered by Centre for Biodiversity Genomics resident arachnologist Dr. Gergin Blagoev and Dr. Charles Dondale from Agriculture and Agri-Food Canada. Continue reading “113/150: A Wolf Spider Like No Other”

110/150: Ant-mimicking spiders; One of these things is not like the other!


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Arachnida: Araneae: Salticidae: Myrmarachne: Myrmarachne formicaria (De Geer, 1778)

Members of the genus Myrmarachne are commonly referred to as the Ant-mimic spiders and represent some of the best examples of Batesian mimicry in the world. Their cephalothorax is elongated, with a tapered waist that imitates the silhouette of an ant and they will often wave their front legs in the air to resemble ant antennae. Continue reading “110/150: Ant-mimicking spiders; One of these things is not like the other!”

57/150: Providing A Good Start: The unique parental care of Wolf Spiders


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Arachnida: Araneae: Lycosidae: Trochosa: Trochosa ruricola (De Geer, 1778)

The Rustic Wolf Spider belongs to the family Lycosidae, and is known for its keen eyesight and skilled hunting. They occur in a wide range of habitats, including grasslands, woodlands, and scrubs across the globe. While many spiders lay their eggs and leave them be, wolf spiders will go the extra mile to protect their young. Continue reading “57/150: Providing A Good Start: The unique parental care of Wolf Spiders”

29/150: Save A Spider Day – The Spined Micrathena


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
animalia: Arthropoda: Arachnida: Araneae: Araneidae: Micrathena: Micrathena gracilis (Walckenaer, 1805)

Micrathena gracilis is a moderately large orb-weaver spider from family Araneidae, commonly known as the spined micrathena. The females are typically black with white markings and have five pairs of black spines which are conical tubercles on the upper side of the abdomen. Continue reading “29/150: Save A Spider Day – The Spined Micrathena”

5/150: Tiny spiders crawl their way into the record books


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22
Animalia: Arthropoda: Arachnida: Araneae: Anapidae: Comaroma: Comaroma mendocino (Levi, 1957)

Comaroma mendocino is a new representative for Canada of the spider family Anapidae. This small rare spider was first described in 1957 by Herbert Levi from the United States in Casper, Mendocino County, California. It was found in British Columbia, Saturna Island by Claudia and Darren Copley with one female specimen collected in October 2013. Continue reading “5/150: Tiny spiders crawl their way into the record books”

Visiting Victoria


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

At the end of October, Gerry Blagoev and I flew across the country to visit the Royal British Columbia Museum (RBCM) in Victoria, British Columbia. We were on a quest for specimens! Identified specimens, that is. Most of the time our collections team is busy finding specimens out in the field and preparing them for DNA barcoding. Once they have a sequence, we determine what the taxonomy of our specimen is based on its sequence. But how do we get to the point where we can determine the taxonomy? How do we know this taxonomy is right? By going to the experts! Continue reading “Visiting Victoria”

A Send Off For Spiders


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Hello everyone,
The summer is quickly coming to a close and with it, my summer position at BIO, but this isn’t the end for me. I’ve been fortunate enough to secure a part-time position once again working on spiders during the upcoming fall semester. In light of this, I figured I would fill this final blog by listing three of my favourite spider species. Continue reading “A Send Off For Spiders”

BIO Blitzes BioBlitzes


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Hi everyone,

I recently got back from another fun weekend of BioBlitzing – this time in the Ojibway Prairie Complex (OPC). The OPC is the equivalent of a gold mine for discovering species that are new to science or Canada. Continue reading “BIO Blitzes BioBlitzes”

Spider Ground Control to Arachnid One


Warning: Use of undefined constant full - assumed 'full' (this will throw an Error in a future version of PHP) in /home/bio/public_html/biobus.ca/wp/wp-content/themes/biobus-blog/template-parts/content.php on line 22

Hi everyone,

I just returned from a week of aquatic sampling at Point Pelee National Park and have much to share. The peninsula that is Point Pelee is the most southern part of Canada and it is revered as one of the best spots in North America to observe the spring migration of songbirds. The park itself exists largely due to the efforts of W.E. Saunders who arrived at Point Pelee in 1882 with the intention of duck hunting. Continue reading “Spider Ground Control to Arachnid One”